Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JSG6

Protein Details
Accession I2JSG6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
127-151GWIQARVTRNKLNRKPNYRKHRRKRBasic
NLS Segment(s)
PositionSequence
135-151RNKLNRKPNYRKHRRKR
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR024156  Small_GTPase_ARF  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
PS51419  RAB  
Amino Acid Sequences MGQNIATVKVDGVYLKIWDVGSQSSLRVLWNEYYNKAHAIILVVDSCDNDRLQRCIMGMKEINANNQAEGLPILMLANKQDLKSPDKMELANLKQLFNPVAENLNAQDSRVLPVSAVTGEGVKEAIGWIQARVTRNKLNRKPNYRKHRRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.11
5 0.11
6 0.13
7 0.12
8 0.14
9 0.14
10 0.13
11 0.13
12 0.13
13 0.13
14 0.13
15 0.14
16 0.15
17 0.2
18 0.23
19 0.24
20 0.27
21 0.27
22 0.27
23 0.26
24 0.23
25 0.17
26 0.15
27 0.13
28 0.11
29 0.1
30 0.09
31 0.08
32 0.08
33 0.09
34 0.09
35 0.08
36 0.1
37 0.11
38 0.13
39 0.14
40 0.15
41 0.14
42 0.16
43 0.17
44 0.19
45 0.18
46 0.17
47 0.22
48 0.22
49 0.23
50 0.22
51 0.22
52 0.17
53 0.16
54 0.15
55 0.09
56 0.09
57 0.07
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.06
65 0.07
66 0.08
67 0.1
68 0.13
69 0.17
70 0.21
71 0.22
72 0.23
73 0.24
74 0.24
75 0.24
76 0.28
77 0.26
78 0.28
79 0.28
80 0.25
81 0.24
82 0.25
83 0.23
84 0.16
85 0.15
86 0.1
87 0.11
88 0.11
89 0.11
90 0.11
91 0.14
92 0.14
93 0.13
94 0.13
95 0.12
96 0.14
97 0.15
98 0.14
99 0.09
100 0.1
101 0.11
102 0.09
103 0.09
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.05
110 0.05
111 0.05
112 0.05
113 0.07
114 0.08
115 0.08
116 0.11
117 0.15
118 0.19
119 0.23
120 0.29
121 0.35
122 0.44
123 0.55
124 0.61
125 0.68
126 0.75
127 0.82
128 0.87
129 0.89
130 0.92
131 0.92