Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194V1V3

Protein Details
Accession A0A194V1V3    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-67MKPYKFDRLRSMRRRIKLRRLHGGBasic
NLS Segment(s)
PositionSequence
56-62RRRIKLR
98-109NKHSSNKVKRRK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR010730  HET  
Pfam View protein in Pfam  
PF06985  HET  
Amino Acid Sequences MDSVMSRQRVTIDNDVYELVSTAVISREQRSRVSKYNDPELTDMKPYKFDRLRSMRRRIKLRRLHGGGLSNTEITCELFEVEYDKDNRNIVRKIPRDNKHSSNKVKRRKYSMSARSQPERLQELVNEGPTGRDSSEYTDVVEYEALSWFWGTENKDCAIRVKKGGEYYRFAVTKELSLALKYLRHADEDRILWIDLLCIDQENHEERNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.26
5 0.2
6 0.12
7 0.08
8 0.07
9 0.07
10 0.07
11 0.1
12 0.12
13 0.15
14 0.2
15 0.23
16 0.3
17 0.35
18 0.4
19 0.46
20 0.52
21 0.55
22 0.55
23 0.63
24 0.59
25 0.56
26 0.53
27 0.46
28 0.41
29 0.41
30 0.39
31 0.3
32 0.34
33 0.33
34 0.39
35 0.41
36 0.42
37 0.46
38 0.53
39 0.63
40 0.65
41 0.75
42 0.73
43 0.76
44 0.83
45 0.83
46 0.83
47 0.82
48 0.8
49 0.8
50 0.76
51 0.71
52 0.64
53 0.6
54 0.51
55 0.44
56 0.37
57 0.27
58 0.22
59 0.2
60 0.16
61 0.11
62 0.1
63 0.07
64 0.06
65 0.05
66 0.05
67 0.07
68 0.07
69 0.1
70 0.13
71 0.14
72 0.14
73 0.16
74 0.18
75 0.21
76 0.22
77 0.25
78 0.32
79 0.35
80 0.43
81 0.51
82 0.56
83 0.57
84 0.62
85 0.64
86 0.64
87 0.69
88 0.69
89 0.7
90 0.73
91 0.77
92 0.79
93 0.76
94 0.75
95 0.73
96 0.71
97 0.71
98 0.71
99 0.71
100 0.69
101 0.69
102 0.64
103 0.61
104 0.55
105 0.48
106 0.42
107 0.33
108 0.26
109 0.21
110 0.22
111 0.21
112 0.2
113 0.16
114 0.13
115 0.12
116 0.12
117 0.12
118 0.08
119 0.08
120 0.08
121 0.13
122 0.16
123 0.16
124 0.16
125 0.15
126 0.15
127 0.14
128 0.14
129 0.09
130 0.06
131 0.07
132 0.06
133 0.06
134 0.06
135 0.05
136 0.06
137 0.1
138 0.12
139 0.14
140 0.17
141 0.18
142 0.2
143 0.2
144 0.26
145 0.29
146 0.3
147 0.32
148 0.33
149 0.35
150 0.41
151 0.48
152 0.46
153 0.45
154 0.44
155 0.46
156 0.43
157 0.4
158 0.36
159 0.3
160 0.27
161 0.24
162 0.24
163 0.17
164 0.17
165 0.17
166 0.16
167 0.18
168 0.17
169 0.21
170 0.2
171 0.24
172 0.25
173 0.28
174 0.32
175 0.31
176 0.33
177 0.29
178 0.28
179 0.24
180 0.22
181 0.19
182 0.13
183 0.12
184 0.1
185 0.09
186 0.09
187 0.1
188 0.15
189 0.18