Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194UMU6

Protein Details
Accession A0A194UMU6   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSKSDSKKASKADKSQKVVAPHydrophilic
392-419LIVTRGKGFTKEKNKKKRGSYRGGFIDVHydrophilic
NLS Segment(s)
PositionSequence
399-410GFTKEKNKKKRG
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MAKSKSDSKKASKADKSQKVVAPPAQLLDLVETFLSSNKFTDAHEAFKQQRSKNGWDSPAKSAQPEGQTLASVFEAWNTSLKSQNASESSSSDSSSSEEEASDVDMKDAAAAESSDSSSSSEDSSDSSDSSESESEDESEKKGAAAAAKSDSSDSSSDSSSDSDSDSDSDSSSDEEDDAATKPSLGAPAAANPLKRKAASDSESSDSDSSDSSSDSDSSSSEDEKPQAKKQKVEESSSDSESESESSSDSSSDDSSDDSSDSDDESEDLKNAANTKLPESDSSSDSSSDSDSDSDDEPAKPVKKQASPPANSGSDSSVTMGKTSPEVSPNTSAPLPPDFTKKNNRGKRDIAPPVKNEPFSRVPRHLQVEEKFKSNAFTDNSHDWGQRAHEDLIVTRGKGFTKEKNKKKRGSYRGGFIDVNAKQGIKFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.82
4 0.81
5 0.76
6 0.72
7 0.7
8 0.64
9 0.58
10 0.49
11 0.44
12 0.37
13 0.33
14 0.27
15 0.23
16 0.18
17 0.13
18 0.12
19 0.1
20 0.1
21 0.12
22 0.14
23 0.11
24 0.12
25 0.13
26 0.14
27 0.14
28 0.23
29 0.23
30 0.27
31 0.3
32 0.36
33 0.39
34 0.46
35 0.54
36 0.48
37 0.54
38 0.56
39 0.59
40 0.62
41 0.64
42 0.65
43 0.65
44 0.66
45 0.64
46 0.66
47 0.59
48 0.51
49 0.46
50 0.43
51 0.38
52 0.36
53 0.32
54 0.24
55 0.24
56 0.23
57 0.21
58 0.16
59 0.13
60 0.11
61 0.1
62 0.1
63 0.1
64 0.13
65 0.13
66 0.15
67 0.2
68 0.21
69 0.23
70 0.22
71 0.27
72 0.26
73 0.28
74 0.27
75 0.23
76 0.27
77 0.25
78 0.24
79 0.19
80 0.17
81 0.16
82 0.16
83 0.16
84 0.11
85 0.1
86 0.1
87 0.1
88 0.11
89 0.13
90 0.11
91 0.1
92 0.1
93 0.09
94 0.1
95 0.1
96 0.08
97 0.05
98 0.05
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.08
105 0.08
106 0.09
107 0.08
108 0.08
109 0.08
110 0.09
111 0.11
112 0.11
113 0.1
114 0.1
115 0.1
116 0.1
117 0.12
118 0.11
119 0.09
120 0.1
121 0.1
122 0.1
123 0.12
124 0.13
125 0.12
126 0.12
127 0.12
128 0.11
129 0.11
130 0.11
131 0.11
132 0.11
133 0.12
134 0.13
135 0.14
136 0.14
137 0.14
138 0.13
139 0.12
140 0.12
141 0.12
142 0.11
143 0.11
144 0.11
145 0.12
146 0.12
147 0.1
148 0.1
149 0.1
150 0.08
151 0.08
152 0.09
153 0.09
154 0.09
155 0.09
156 0.08
157 0.08
158 0.08
159 0.08
160 0.07
161 0.06
162 0.06
163 0.05
164 0.06
165 0.07
166 0.08
167 0.07
168 0.07
169 0.07
170 0.07
171 0.08
172 0.07
173 0.07
174 0.06
175 0.08
176 0.13
177 0.14
178 0.15
179 0.15
180 0.18
181 0.19
182 0.19
183 0.18
184 0.18
185 0.23
186 0.25
187 0.27
188 0.27
189 0.28
190 0.28
191 0.28
192 0.24
193 0.18
194 0.15
195 0.12
196 0.09
197 0.07
198 0.07
199 0.06
200 0.07
201 0.07
202 0.07
203 0.07
204 0.07
205 0.08
206 0.08
207 0.09
208 0.1
209 0.11
210 0.13
211 0.18
212 0.21
213 0.27
214 0.35
215 0.36
216 0.4
217 0.45
218 0.52
219 0.51
220 0.51
221 0.47
222 0.46
223 0.46
224 0.42
225 0.37
226 0.27
227 0.24
228 0.2
229 0.18
230 0.11
231 0.08
232 0.07
233 0.07
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.07
241 0.07
242 0.08
243 0.08
244 0.08
245 0.07
246 0.07
247 0.07
248 0.07
249 0.07
250 0.06
251 0.06
252 0.07
253 0.07
254 0.07
255 0.07
256 0.07
257 0.08
258 0.1
259 0.1
260 0.12
261 0.13
262 0.15
263 0.18
264 0.19
265 0.19
266 0.23
267 0.24
268 0.22
269 0.24
270 0.22
271 0.19
272 0.19
273 0.18
274 0.13
275 0.11
276 0.1
277 0.09
278 0.08
279 0.1
280 0.1
281 0.11
282 0.13
283 0.12
284 0.13
285 0.18
286 0.2
287 0.19
288 0.23
289 0.29
290 0.33
291 0.39
292 0.48
293 0.53
294 0.54
295 0.57
296 0.57
297 0.52
298 0.47
299 0.41
300 0.33
301 0.24
302 0.22
303 0.19
304 0.16
305 0.14
306 0.14
307 0.13
308 0.12
309 0.12
310 0.13
311 0.14
312 0.15
313 0.17
314 0.2
315 0.23
316 0.23
317 0.25
318 0.24
319 0.23
320 0.22
321 0.23
322 0.23
323 0.21
324 0.28
325 0.28
326 0.34
327 0.44
328 0.51
329 0.59
330 0.64
331 0.69
332 0.69
333 0.72
334 0.74
335 0.73
336 0.74
337 0.73
338 0.72
339 0.69
340 0.7
341 0.69
342 0.65
343 0.56
344 0.52
345 0.51
346 0.51
347 0.55
348 0.52
349 0.52
350 0.56
351 0.62
352 0.59
353 0.59
354 0.58
355 0.6
356 0.57
357 0.55
358 0.48
359 0.42
360 0.41
361 0.34
362 0.35
363 0.28
364 0.28
365 0.31
366 0.34
367 0.37
368 0.37
369 0.37
370 0.31
371 0.3
372 0.3
373 0.28
374 0.28
375 0.25
376 0.24
377 0.24
378 0.24
379 0.28
380 0.27
381 0.24
382 0.21
383 0.22
384 0.21
385 0.27
386 0.31
387 0.35
388 0.44
389 0.54
390 0.64
391 0.73
392 0.82
393 0.85
394 0.9
395 0.91
396 0.9
397 0.91
398 0.88
399 0.86
400 0.83
401 0.8
402 0.69
403 0.59
404 0.58
405 0.47
406 0.43
407 0.35
408 0.28
409 0.23