Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JTZ8

Protein Details
Accession I2JTZ8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-54DIVIKAPTVNRKRPRRMSKRLQNKSKANNTIHydrophilic
NLS Segment(s)
PositionSequence
10-18ARKRGSARR
32-47XVNRKRXPRRMSKRLX
Subcellular Location(s) mito 13, cyto_nucl 9, nucl 7, cyto 7
Family & Domain DBs
Amino Acid Sequences MFSRVAGREARKRGSARRHVNVGDIVIKAPTXVNRKRXPRRMSKRLXQNKSKANNTIQIDDVALGXTFLDSDSDSDSDSDSDSDSDSDSDSDDNEQFVDSREHXVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.69
4 0.69
5 0.71
6 0.65
7 0.63
8 0.55
9 0.46
10 0.39
11 0.29
12 0.23
13 0.16
14 0.15
15 0.12
16 0.12
17 0.19
18 0.23
19 0.32
20 0.42
21 0.52
22 0.62
23 0.72
24 0.81
25 0.82
26 0.86
27 0.88
28 0.88
29 0.9
30 0.9
31 0.89
32 0.87
33 0.84
34 0.83
35 0.8
36 0.76
37 0.66
38 0.63
39 0.55
40 0.48
41 0.4
42 0.32
43 0.23
44 0.17
45 0.16
46 0.08
47 0.06
48 0.05
49 0.04
50 0.04
51 0.03
52 0.04
53 0.04
54 0.04
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.11
80 0.13
81 0.15