Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168BMV3

Protein Details
Accession A0A168BMV3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-49ATMNGDTPRQQRRRRPRPGPVLQRFRRGAHydrophilic
NLS Segment(s)
PositionSequence
32-40RRRRPRPGP
Subcellular Location(s) plas 14, cyto 5.5, cyto_nucl 4, mito 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004713  CaH_exchang  
Gene Ontology GO:0016020  C:membrane  
GO:0015085  F:calcium ion transmembrane transporter activity  
Amino Acid Sequences MSSAGVATPPLGGEESLPLLATMNGDTPRQQRRRRPRPGPVLQRFRRGAVHALYASLTCSYSNVLLPCVPLGLLASGWGWPPAVIFALNFLAMLPLASILTFGTEQLAAIVGSVAGGLINATFGNAVEMITFLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.1
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.09
11 0.11
12 0.12
13 0.15
14 0.21
15 0.31
16 0.4
17 0.47
18 0.55
19 0.65
20 0.75
21 0.83
22 0.86
23 0.86
24 0.88
25 0.9
26 0.91
27 0.89
28 0.89
29 0.83
30 0.81
31 0.72
32 0.64
33 0.56
34 0.47
35 0.41
36 0.31
37 0.31
38 0.22
39 0.21
40 0.19
41 0.16
42 0.15
43 0.11
44 0.09
45 0.05
46 0.06
47 0.06
48 0.06
49 0.08
50 0.07
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.04
58 0.04
59 0.04
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.04
72 0.04
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.03
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.03
101 0.03
102 0.02
103 0.02
104 0.02
105 0.02
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.06
112 0.06
113 0.06
114 0.06