Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JRX8

Protein Details
Accession I2JRX8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
89-121GELRRAKSSARELRKRRSNPPKEKAKPKYTTMGHydrophilic
NLS Segment(s)
PositionSequence
92-117LRRAKSSARELRKRRSNPPKEKAKPK
Subcellular Location(s) cyto_nucl 14.833, nucl 14.5, cyto 11, mito_nucl 8.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR036786  Ribosome_mat_SBDS_N_sf  
IPR019783  SDO1/SBDS_N  
Pfam View protein in Pfam  
PF01172  SBDS  
Amino Acid Sequences MPEVXKVFYRGSKSDFSVFLDSVDAYKKWASGDKTVPLSDVISSFIVYTPVTGNGTEGEIHEASKQVLEEEFGKFDSVDTTVIPKILREGELRRAKSSARELRKRRSNPPKEKAKPKYTTMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.32
4 0.3
5 0.27
6 0.23
7 0.2
8 0.17
9 0.19
10 0.14
11 0.12
12 0.13
13 0.13
14 0.13
15 0.19
16 0.21
17 0.24
18 0.28
19 0.31
20 0.34
21 0.33
22 0.33
23 0.28
24 0.25
25 0.2
26 0.15
27 0.12
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.08
35 0.06
36 0.07
37 0.08
38 0.08
39 0.08
40 0.07
41 0.08
42 0.08
43 0.07
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.05
53 0.05
54 0.06
55 0.07
56 0.08
57 0.08
58 0.08
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.09
67 0.09
68 0.1
69 0.1
70 0.09
71 0.11
72 0.12
73 0.14
74 0.15
75 0.18
76 0.27
77 0.36
78 0.38
79 0.38
80 0.38
81 0.37
82 0.4
83 0.47
84 0.47
85 0.49
86 0.57
87 0.63
88 0.72
89 0.81
90 0.81
91 0.82
92 0.84
93 0.84
94 0.85
95 0.87
96 0.88
97 0.88
98 0.92
99 0.92
100 0.91
101 0.86