Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JXW3

Protein Details
Accession I2JXW3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-122YEEYKVWTDKRKKPQQEKIIEVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000651  Ras-like_Gua-exchang_fac_N  
IPR023578  Ras_GEF_dom_sf  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF00618  RasGEF_N  
PROSITE View protein in PROSITE  
PS50212  RASGEF_NTER  
CDD cd06224  REM  
Amino Acid Sequences MSTTASQSDFYYGHKXSSESSATPWYLDTSDDEKQLVYSPEGLRGGMVEGLVAKLVDPFISDDKEYIKCFLLTFITFVTPVRLFDLLEQKYNLEMPEGLSYEEYKVWTDKRKKPQQEKIIEVIRLLFTKFWNVNYRSLLLEEKWDSMITEMSINEELSQLGRKVLSFADQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.28
5 0.27
6 0.23
7 0.25
8 0.24
9 0.24
10 0.23
11 0.23
12 0.17
13 0.15
14 0.18
15 0.19
16 0.2
17 0.21
18 0.2
19 0.19
20 0.19
21 0.21
22 0.18
23 0.14
24 0.17
25 0.17
26 0.2
27 0.21
28 0.2
29 0.17
30 0.16
31 0.15
32 0.1
33 0.1
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.06
45 0.08
46 0.1
47 0.1
48 0.1
49 0.13
50 0.16
51 0.16
52 0.16
53 0.15
54 0.14
55 0.14
56 0.14
57 0.13
58 0.11
59 0.11
60 0.1
61 0.09
62 0.09
63 0.09
64 0.11
65 0.09
66 0.09
67 0.1
68 0.09
69 0.09
70 0.11
71 0.19
72 0.17
73 0.18
74 0.18
75 0.17
76 0.17
77 0.17
78 0.15
79 0.08
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.08
86 0.09
87 0.09
88 0.1
89 0.09
90 0.08
91 0.1
92 0.13
93 0.22
94 0.31
95 0.39
96 0.49
97 0.59
98 0.69
99 0.77
100 0.84
101 0.85
102 0.84
103 0.8
104 0.76
105 0.72
106 0.62
107 0.51
108 0.42
109 0.34
110 0.26
111 0.22
112 0.16
113 0.11
114 0.17
115 0.18
116 0.21
117 0.28
118 0.3
119 0.34
120 0.35
121 0.36
122 0.3
123 0.31
124 0.3
125 0.22
126 0.25
127 0.22
128 0.21
129 0.21
130 0.2
131 0.18
132 0.16
133 0.17
134 0.12
135 0.12
136 0.1
137 0.12
138 0.13
139 0.13
140 0.13
141 0.12
142 0.11
143 0.11
144 0.15
145 0.12
146 0.13
147 0.13
148 0.13
149 0.14
150 0.15