Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JUZ0

Protein Details
Accession I2JUZ0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-35PGGAKTLSKRRANKENKLRQQKLNKPNSSRHydrophilic
NLS Segment(s)
PositionSequence
14-24KRRANKENKLR
Subcellular Location(s) plas 17, mito 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR030671  Sec61-beta/Sbh  
IPR016482  SecG/Sec61-beta/Sbh  
Gene Ontology GO:0005784  C:Sec61 translocon complex  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF03911  Sec61_beta  
Amino Acid Sequences MSSSIPGGAKTLSKRRANKENKLRQQKLNKPNSSRAAGAGGSSSSMLKIYTDEADGFKIDPLVVLIFAVAFIFSVVVLHVISKLTGKIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.7
4 0.75
5 0.79
6 0.81
7 0.83
8 0.85
9 0.88
10 0.86
11 0.84
12 0.86
13 0.85
14 0.84
15 0.84
16 0.81
17 0.75
18 0.77
19 0.73
20 0.65
21 0.55
22 0.46
23 0.37
24 0.3
25 0.24
26 0.16
27 0.11
28 0.08
29 0.08
30 0.07
31 0.04
32 0.05
33 0.04
34 0.04
35 0.05
36 0.06
37 0.06
38 0.07
39 0.08
40 0.08
41 0.09
42 0.09
43 0.09
44 0.08
45 0.08
46 0.07
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.07
69 0.08