Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167X776

Protein Details
Accession A0A167X776    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSRFQKRRQRLRLRAVDSVHydrophilic
75-95KDKYTMFDRKAKRYRKGIHSABasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSRFQKRRQRLRLRAVDSVVATLDAALAKKGQTLEALERWKAEMPTEAEMLPKDKYTMFDRKAKRYRKGIHSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.25
8 0.28
9 0.35
10 0.44
11 0.55
12 0.6
13 0.69
14 0.76
15 0.81
16 0.86
17 0.89
18 0.89
19 0.88
20 0.89
21 0.88
22 0.83
23 0.76
24 0.67
25 0.58
26 0.46
27 0.37
28 0.26
29 0.17
30 0.11
31 0.07
32 0.06
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.06
41 0.07
42 0.09
43 0.12
44 0.16
45 0.19
46 0.18
47 0.18
48 0.19
49 0.21
50 0.19
51 0.17
52 0.17
53 0.16
54 0.19
55 0.2
56 0.18
57 0.17
58 0.18
59 0.19
60 0.15
61 0.13
62 0.12
63 0.12
64 0.16
65 0.21
66 0.3
67 0.33
68 0.41
69 0.48
70 0.57
71 0.66
72 0.72
73 0.75
74 0.75
75 0.8