Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WHK5

Protein Details
Accession G0WHK5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-24TWNIIGKKEKKEPPNTRNARRLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0045277  C:respiratory chain complex IV  
KEGG ndi:NDAI_0K00750  -  
Pfam View protein in Pfam  
PF02297  COX6B  
Amino Acid Sequences MTWNIIGKKEKKEPPNTRNARRLCWDSRDEYFKCLDSINVINPLDPKNSKKIQTSCKEQSNQFDQNCATSWIKYFKEKRFVDYKRERMLKEVEEQQELRDSERKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.84
4 0.83
5 0.84
6 0.79
7 0.73
8 0.69
9 0.68
10 0.62
11 0.59
12 0.55
13 0.5
14 0.51
15 0.52
16 0.46
17 0.42
18 0.38
19 0.32
20 0.28
21 0.24
22 0.19
23 0.15
24 0.16
25 0.15
26 0.18
27 0.17
28 0.17
29 0.18
30 0.19
31 0.19
32 0.2
33 0.2
34 0.22
35 0.26
36 0.29
37 0.34
38 0.39
39 0.45
40 0.49
41 0.55
42 0.55
43 0.58
44 0.58
45 0.53
46 0.52
47 0.51
48 0.52
49 0.43
50 0.4
51 0.33
52 0.31
53 0.29
54 0.28
55 0.22
56 0.15
57 0.18
58 0.21
59 0.23
60 0.3
61 0.37
62 0.4
63 0.49
64 0.5
65 0.53
66 0.57
67 0.59
68 0.62
69 0.64
70 0.66
71 0.66
72 0.71
73 0.66
74 0.61
75 0.63
76 0.55
77 0.52
78 0.52
79 0.45
80 0.44
81 0.44
82 0.41
83 0.42
84 0.39
85 0.36