Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168CHF5

Protein Details
Accession A0A168CHF5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-40ASSARIKKNKKSNNVKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKNKK
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKFIEICRRKDASSARIKKNKKSNNVKFKVRCQKHLYTLVLKDTDKAEKLKQSLPPTLSISEVGKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.5
4 0.45
5 0.51
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.66
12 0.7
13 0.72
14 0.76
15 0.75
16 0.74
17 0.77
18 0.77
19 0.8
20 0.83
21 0.84
22 0.78
23 0.8
24 0.8
25 0.72
26 0.69
27 0.64
28 0.62
29 0.59
30 0.62
31 0.55
32 0.49
33 0.48
34 0.44
35 0.4
36 0.35
37 0.3
38 0.25
39 0.25
40 0.23
41 0.24
42 0.24
43 0.27
44 0.31
45 0.34
46 0.39
47 0.41
48 0.46
49 0.45
50 0.45
51 0.43
52 0.4
53 0.36
54 0.32
55 0.29