Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167Y261

Protein Details
Accession A0A167Y261    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-127PVNVDPSKKPPSRKKRKIPRSGTPATLHydrophilic
NLS Segment(s)
PositionSequence
108-121KKPPSRKKRKIPRS
Subcellular Location(s) plas 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004299  MBOAT_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF03062  MBOAT  
Amino Acid Sequences MGHMSISHIRRQASSDASCIDITGAQMVMVMKLSAFCWNVADGQLPPELLSDFQKDRALREFPSLTDYAGYVLFFPSLFAGPAFDFADYARWIDTSMFDIPVNVDPSKKPPSRKKRKIPRSGTPATLKALTGLAWIGLFVILSSRFGHEELYKQTYIRHDLWRRVWIMYMVNLVARLKYYGVWTLTEGSCILAGLGYNGIDAVTGKVFWNRLQNIDPWAVETAQNPRGYLAGWNMNTNNWLRNYIYLRVTPRGKKPGFRASIMTFGTSAIWHGFYPGYYLTFILASLVQTAAKNCRRLIRPFFLDTTSGEPKSTKKYYDIASFVITQLTFSFTTTPFLVLSFSDSVRVWSRVYFYGAVWTLVCLVFFASGAKGALKARLDKRQGRANAKMVRSMSTDSLTGKEPILGISKDLESDMTQAMEEIKAEIDLRQRKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.33
4 0.33
5 0.32
6 0.28
7 0.23
8 0.16
9 0.14
10 0.12
11 0.11
12 0.08
13 0.1
14 0.1
15 0.09
16 0.09
17 0.09
18 0.07
19 0.08
20 0.09
21 0.12
22 0.13
23 0.13
24 0.14
25 0.15
26 0.16
27 0.16
28 0.17
29 0.13
30 0.14
31 0.15
32 0.14
33 0.13
34 0.13
35 0.13
36 0.12
37 0.15
38 0.18
39 0.19
40 0.22
41 0.27
42 0.27
43 0.29
44 0.34
45 0.34
46 0.31
47 0.36
48 0.34
49 0.3
50 0.35
51 0.32
52 0.26
53 0.23
54 0.21
55 0.15
56 0.14
57 0.13
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.07
67 0.09
68 0.09
69 0.11
70 0.11
71 0.1
72 0.09
73 0.09
74 0.13
75 0.12
76 0.12
77 0.1
78 0.09
79 0.1
80 0.11
81 0.11
82 0.11
83 0.12
84 0.13
85 0.13
86 0.13
87 0.14
88 0.17
89 0.2
90 0.16
91 0.17
92 0.17
93 0.23
94 0.32
95 0.35
96 0.41
97 0.49
98 0.6
99 0.7
100 0.8
101 0.85
102 0.87
103 0.93
104 0.95
105 0.93
106 0.91
107 0.89
108 0.83
109 0.79
110 0.73
111 0.64
112 0.56
113 0.48
114 0.37
115 0.28
116 0.24
117 0.17
118 0.12
119 0.09
120 0.07
121 0.06
122 0.05
123 0.04
124 0.04
125 0.04
126 0.03
127 0.04
128 0.04
129 0.06
130 0.07
131 0.08
132 0.09
133 0.09
134 0.11
135 0.11
136 0.15
137 0.18
138 0.22
139 0.22
140 0.21
141 0.24
142 0.25
143 0.3
144 0.3
145 0.35
146 0.35
147 0.42
148 0.45
149 0.48
150 0.46
151 0.41
152 0.38
153 0.31
154 0.26
155 0.21
156 0.18
157 0.13
158 0.11
159 0.12
160 0.11
161 0.09
162 0.08
163 0.07
164 0.06
165 0.07
166 0.08
167 0.11
168 0.11
169 0.12
170 0.12
171 0.15
172 0.15
173 0.14
174 0.13
175 0.1
176 0.09
177 0.08
178 0.07
179 0.04
180 0.04
181 0.03
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.03
191 0.04
192 0.05
193 0.06
194 0.07
195 0.09
196 0.15
197 0.16
198 0.18
199 0.19
200 0.2
201 0.22
202 0.23
203 0.21
204 0.15
205 0.15
206 0.13
207 0.12
208 0.12
209 0.14
210 0.17
211 0.18
212 0.17
213 0.16
214 0.16
215 0.15
216 0.15
217 0.13
218 0.14
219 0.14
220 0.16
221 0.16
222 0.16
223 0.17
224 0.17
225 0.17
226 0.13
227 0.14
228 0.13
229 0.17
230 0.2
231 0.22
232 0.23
233 0.23
234 0.25
235 0.29
236 0.35
237 0.36
238 0.39
239 0.45
240 0.45
241 0.47
242 0.51
243 0.55
244 0.53
245 0.49
246 0.47
247 0.39
248 0.44
249 0.39
250 0.33
251 0.23
252 0.2
253 0.18
254 0.14
255 0.12
256 0.07
257 0.07
258 0.06
259 0.07
260 0.07
261 0.07
262 0.09
263 0.08
264 0.09
265 0.08
266 0.08
267 0.08
268 0.08
269 0.08
270 0.07
271 0.06
272 0.05
273 0.06
274 0.06
275 0.06
276 0.07
277 0.09
278 0.16
279 0.21
280 0.24
281 0.25
282 0.32
283 0.36
284 0.43
285 0.5
286 0.5
287 0.5
288 0.5
289 0.51
290 0.45
291 0.41
292 0.35
293 0.34
294 0.3
295 0.26
296 0.23
297 0.22
298 0.24
299 0.31
300 0.33
301 0.28
302 0.27
303 0.31
304 0.35
305 0.4
306 0.4
307 0.33
308 0.32
309 0.31
310 0.27
311 0.24
312 0.2
313 0.14
314 0.11
315 0.13
316 0.11
317 0.1
318 0.13
319 0.11
320 0.14
321 0.15
322 0.15
323 0.12
324 0.12
325 0.12
326 0.1
327 0.13
328 0.13
329 0.12
330 0.14
331 0.14
332 0.16
333 0.19
334 0.21
335 0.18
336 0.17
337 0.21
338 0.2
339 0.24
340 0.22
341 0.19
342 0.24
343 0.24
344 0.23
345 0.2
346 0.18
347 0.16
348 0.15
349 0.14
350 0.08
351 0.07
352 0.07
353 0.07
354 0.07
355 0.06
356 0.07
357 0.08
358 0.08
359 0.1
360 0.11
361 0.16
362 0.18
363 0.26
364 0.31
365 0.4
366 0.49
367 0.54
368 0.6
369 0.64
370 0.7
371 0.7
372 0.71
373 0.71
374 0.71
375 0.65
376 0.65
377 0.57
378 0.51
379 0.46
380 0.42
381 0.36
382 0.29
383 0.29
384 0.24
385 0.25
386 0.24
387 0.23
388 0.19
389 0.18
390 0.16
391 0.17
392 0.2
393 0.19
394 0.17
395 0.19
396 0.19
397 0.18
398 0.18
399 0.18
400 0.13
401 0.15
402 0.15
403 0.13
404 0.12
405 0.12
406 0.13
407 0.12
408 0.11
409 0.1
410 0.09
411 0.1
412 0.1
413 0.13
414 0.21
415 0.28