Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167WG37

Protein Details
Accession A0A167WG37    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MASQRKARKRRTSKFSKRKQTVLRKAHEHydrophilic
NLS Segment(s)
PositionSequence
5-20RKARKRRTSKFSKRKQ
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MASQRKARKRRTSKFSKRKQTVLRKAHELQRDCDAEVYLYVRNKRSNQVWRYTSGIQPPLETEMVCLIHTAEVIMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.89
5 0.88
6 0.88
7 0.88
8 0.87
9 0.85
10 0.8
11 0.76
12 0.74
13 0.71
14 0.69
15 0.6
16 0.51
17 0.48
18 0.44
19 0.37
20 0.33
21 0.26
22 0.18
23 0.15
24 0.15
25 0.1
26 0.12
27 0.14
28 0.16
29 0.2
30 0.22
31 0.26
32 0.33
33 0.4
34 0.43
35 0.49
36 0.49
37 0.48
38 0.51
39 0.49
40 0.44
41 0.4
42 0.4
43 0.32
44 0.3
45 0.28
46 0.27
47 0.25
48 0.21
49 0.17
50 0.15
51 0.16
52 0.15
53 0.14
54 0.11
55 0.11
56 0.11