Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K1S3

Protein Details
Accession I2K1S3    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-100DGSPCYRIRRKGERRRKSIRGCIVGBasic
176-197VTPQRLQRKRAVRAHKIKNAQAHydrophilic
NLS Segment(s)
PositionSequence
87-96RRKGERRRKS
166-196EKKYTKAPKIQRLVTPQRLQRKRAVRAHKIK
219-235RKAEKAEIRKRRASSLK
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNIAXPANGTQKSIDIDDELKLRTFYEKRIGQEVQADDLGDEFKGYXFKXAGGNDKQGFPMRQGIVAPGRVKLLFADGSPCYRIRRKGERRRKSIRGCIVGSDLAALNLIVIKQGEKDIEGLTDVQAPKRLGPKRANNIRKFFGLTKEDDVRQFVIRRELVKGEKKYTKAPKIQRLVTPQRLQRKRAVRAHKIKNAQAQRDAAAEYAQLLATRLHERKAEKAEIRKRRASSLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.16
4 0.17
5 0.18
6 0.2
7 0.2
8 0.19
9 0.18
10 0.17
11 0.23
12 0.23
13 0.25
14 0.33
15 0.36
16 0.38
17 0.45
18 0.45
19 0.39
20 0.44
21 0.41
22 0.34
23 0.3
24 0.26
25 0.19
26 0.19
27 0.17
28 0.1
29 0.09
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.09
36 0.15
37 0.2
38 0.25
39 0.31
40 0.34
41 0.34
42 0.38
43 0.41
44 0.36
45 0.33
46 0.34
47 0.29
48 0.26
49 0.26
50 0.24
51 0.23
52 0.26
53 0.25
54 0.19
55 0.2
56 0.19
57 0.18
58 0.15
59 0.15
60 0.11
61 0.1
62 0.13
63 0.12
64 0.14
65 0.16
66 0.17
67 0.18
68 0.22
69 0.29
70 0.34
71 0.44
72 0.54
73 0.63
74 0.73
75 0.79
76 0.84
77 0.87
78 0.88
79 0.86
80 0.84
81 0.81
82 0.75
83 0.66
84 0.58
85 0.5
86 0.4
87 0.32
88 0.23
89 0.15
90 0.08
91 0.08
92 0.06
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.1
110 0.1
111 0.09
112 0.13
113 0.13
114 0.15
115 0.23
116 0.26
117 0.29
118 0.37
119 0.45
120 0.52
121 0.62
122 0.7
123 0.69
124 0.71
125 0.66
126 0.6
127 0.54
128 0.46
129 0.42
130 0.36
131 0.31
132 0.31
133 0.32
134 0.31
135 0.29
136 0.29
137 0.24
138 0.24
139 0.24
140 0.21
141 0.24
142 0.24
143 0.25
144 0.25
145 0.28
146 0.32
147 0.38
148 0.41
149 0.42
150 0.45
151 0.46
152 0.53
153 0.59
154 0.6
155 0.61
156 0.66
157 0.69
158 0.71
159 0.73
160 0.7
161 0.7
162 0.71
163 0.71
164 0.69
165 0.66
166 0.69
167 0.7
168 0.68
169 0.67
170 0.67
171 0.68
172 0.7
173 0.74
174 0.74
175 0.78
176 0.84
177 0.84
178 0.82
179 0.79
180 0.79
181 0.77
182 0.72
183 0.67
184 0.6
185 0.52
186 0.46
187 0.41
188 0.32
189 0.23
190 0.17
191 0.12
192 0.11
193 0.09
194 0.08
195 0.08
196 0.08
197 0.11
198 0.19
199 0.2
200 0.23
201 0.28
202 0.31
203 0.38
204 0.44
205 0.5
206 0.5
207 0.59
208 0.66
209 0.72
210 0.77
211 0.77
212 0.73
213 0.74