Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JZ42

Protein Details
Accession I2JZ42   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-42SKKVNKKILKTVKRASKCKHVKRGVKEVVKBasic
NLS Segment(s)
PositionSequence
12-46ASKKVNKKILKTVKRASKCKHVKRGVKEVVKALRK
Subcellular Location(s) cyto 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MPAVLPFAKPLASKKVNKKILKTVKRASKCKHVKRGVKEVVKALRKGDKGLVIIAGDIFPMDVISHLPVLCEDNEVPYIFIPSKQDLGSAGATKKTNIVCDDSSRRWITQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.61
3 0.68
4 0.72
5 0.74
6 0.75
7 0.78
8 0.79
9 0.77
10 0.76
11 0.76
12 0.8
13 0.82
14 0.77
15 0.77
16 0.78
17 0.8
18 0.81
19 0.81
20 0.8
21 0.79
22 0.84
23 0.83
24 0.77
25 0.7
26 0.65
27 0.64
28 0.6
29 0.53
30 0.45
31 0.42
32 0.37
33 0.36
34 0.32
35 0.27
36 0.22
37 0.22
38 0.19
39 0.13
40 0.12
41 0.1
42 0.08
43 0.05
44 0.04
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.03
51 0.04
52 0.05
53 0.05
54 0.05
55 0.06
56 0.07
57 0.07
58 0.09
59 0.08
60 0.09
61 0.11
62 0.11
63 0.11
64 0.09
65 0.12
66 0.1
67 0.12
68 0.13
69 0.14
70 0.16
71 0.15
72 0.16
73 0.15
74 0.17
75 0.18
76 0.19
77 0.19
78 0.21
79 0.21
80 0.21
81 0.25
82 0.24
83 0.25
84 0.24
85 0.28
86 0.26
87 0.34
88 0.42
89 0.41
90 0.47
91 0.46