Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K2U3

Protein Details
Accession I2K2U3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-101GGNNYQRRGNRRNYNGNQRYGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR034101  Lsm4  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0120114  C:Sm-like protein family complex  
GO:0005681  C:spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01723  LSm4  
Amino Acid Sequences MVELKRGETLNGTLTNCDSWMNITMKDIVVSDAHGENFYKLKSTYVKGIHIKYITMSNDLIDKFREEQLKEREYYRHRNNGGNNYQRRGNRRNYNGNQRYGGHSNRSQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.2
4 0.18
5 0.13
6 0.11
7 0.16
8 0.17
9 0.16
10 0.16
11 0.18
12 0.17
13 0.17
14 0.16
15 0.11
16 0.09
17 0.1
18 0.1
19 0.1
20 0.1
21 0.1
22 0.1
23 0.1
24 0.11
25 0.11
26 0.11
27 0.1
28 0.13
29 0.15
30 0.16
31 0.22
32 0.23
33 0.29
34 0.32
35 0.33
36 0.33
37 0.3
38 0.29
39 0.23
40 0.24
41 0.19
42 0.16
43 0.15
44 0.11
45 0.14
46 0.14
47 0.14
48 0.1
49 0.11
50 0.12
51 0.15
52 0.19
53 0.18
54 0.25
55 0.32
56 0.35
57 0.35
58 0.35
59 0.39
60 0.41
61 0.51
62 0.51
63 0.53
64 0.52
65 0.57
66 0.62
67 0.64
68 0.68
69 0.67
70 0.64
71 0.59
72 0.62
73 0.61
74 0.62
75 0.59
76 0.6
77 0.61
78 0.65
79 0.72
80 0.75
81 0.81
82 0.81
83 0.8
84 0.74
85 0.66
86 0.64
87 0.59
88 0.55
89 0.51