Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2K118

Protein Details
Accession I2K118    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-85EAAIRKINKKRSSKNTPQFLNHydrophilic
NLS Segment(s)
PositionSequence
50-77KMKVNRKSTRRGKQFEAAIRKINKKRSS
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027312  Sda1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0015031  P:protein transport  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0000055  P:ribosomal large subunit export from nucleus  
Amino Acid Sequences MTQACLHPDTKVVISGVKFFLGSDKEREEAMQEEIDEDDDDIDPKALIHKMKVNRKSTRRGKQFEAAIRKINKKRSSKNTPQFLNFSAIQLLRDPQQFAEDLFQSHLSGKKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.2
4 0.18
5 0.16
6 0.14
7 0.18
8 0.18
9 0.19
10 0.2
11 0.21
12 0.22
13 0.22
14 0.22
15 0.2
16 0.18
17 0.18
18 0.15
19 0.12
20 0.12
21 0.12
22 0.13
23 0.1
24 0.09
25 0.07
26 0.06
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.07
33 0.09
34 0.09
35 0.11
36 0.17
37 0.24
38 0.33
39 0.41
40 0.47
41 0.53
42 0.58
43 0.66
44 0.7
45 0.73
46 0.74
47 0.71
48 0.68
49 0.65
50 0.66
51 0.63
52 0.61
53 0.53
54 0.51
55 0.51
56 0.55
57 0.55
58 0.58
59 0.6
60 0.6
61 0.67
62 0.71
63 0.76
64 0.79
65 0.82
66 0.82
67 0.79
68 0.74
69 0.68
70 0.6
71 0.54
72 0.43
73 0.35
74 0.29
75 0.24
76 0.21
77 0.18
78 0.18
79 0.17
80 0.19
81 0.19
82 0.16
83 0.18
84 0.18
85 0.18
86 0.21
87 0.18
88 0.17
89 0.18
90 0.19
91 0.17
92 0.2