Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166RPR8

Protein Details
Accession A0A166RPR8   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-112PSPPPTPKDKPLRIKRGHRKSALBasic
NLS Segment(s)
PositionSequence
96-109PKDKPLRIKRGHRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF09011  HMG_box_2  
Amino Acid Sequences MTEPKKRPSNTEPQSAVPPSLPPSVEEAYRRKCVQLKNRTSEVEDANDAARLRLARIKRQVEKLRIERAFLLEQLSKRTSANVEDSEGSPSPPPTPKDKPLRIKRGHRKSALADVDAKAASHNKEPASPSEFPPKDEDGTEANPTNGVSATSKGARSAFHLYTLTARPLLEEKYKDDEGDADIDDELARGWDDLAASEKEEYRRKFAAKQEADKEEKDADDETLEKERKSGEKADAQDEDVEMTNYDSEDQDQDGETQLDKDGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.51
4 0.4
5 0.36
6 0.3
7 0.3
8 0.27
9 0.21
10 0.25
11 0.26
12 0.28
13 0.31
14 0.36
15 0.38
16 0.44
17 0.44
18 0.43
19 0.48
20 0.54
21 0.59
22 0.62
23 0.66
24 0.67
25 0.72
26 0.69
27 0.66
28 0.61
29 0.54
30 0.46
31 0.37
32 0.3
33 0.25
34 0.25
35 0.22
36 0.17
37 0.15
38 0.12
39 0.13
40 0.18
41 0.22
42 0.28
43 0.37
44 0.46
45 0.5
46 0.6
47 0.67
48 0.69
49 0.74
50 0.72
51 0.73
52 0.65
53 0.6
54 0.52
55 0.47
56 0.4
57 0.31
58 0.29
59 0.22
60 0.23
61 0.26
62 0.25
63 0.22
64 0.21
65 0.22
66 0.2
67 0.19
68 0.23
69 0.19
70 0.2
71 0.2
72 0.21
73 0.23
74 0.21
75 0.19
76 0.15
77 0.15
78 0.16
79 0.19
80 0.2
81 0.24
82 0.3
83 0.38
84 0.47
85 0.55
86 0.63
87 0.69
88 0.77
89 0.78
90 0.83
91 0.85
92 0.86
93 0.86
94 0.78
95 0.72
96 0.65
97 0.65
98 0.56
99 0.47
100 0.39
101 0.31
102 0.29
103 0.24
104 0.21
105 0.13
106 0.13
107 0.13
108 0.12
109 0.14
110 0.13
111 0.16
112 0.17
113 0.19
114 0.23
115 0.23
116 0.23
117 0.31
118 0.31
119 0.3
120 0.32
121 0.31
122 0.26
123 0.25
124 0.24
125 0.17
126 0.18
127 0.19
128 0.16
129 0.14
130 0.13
131 0.13
132 0.11
133 0.09
134 0.08
135 0.06
136 0.07
137 0.09
138 0.1
139 0.1
140 0.11
141 0.12
142 0.11
143 0.14
144 0.19
145 0.17
146 0.18
147 0.18
148 0.18
149 0.2
150 0.21
151 0.19
152 0.14
153 0.13
154 0.12
155 0.14
156 0.16
157 0.18
158 0.18
159 0.2
160 0.25
161 0.26
162 0.25
163 0.23
164 0.21
165 0.18
166 0.18
167 0.15
168 0.09
169 0.09
170 0.09
171 0.08
172 0.07
173 0.06
174 0.05
175 0.04
176 0.04
177 0.04
178 0.05
179 0.05
180 0.05
181 0.09
182 0.09
183 0.1
184 0.11
185 0.14
186 0.19
187 0.26
188 0.28
189 0.3
190 0.35
191 0.37
192 0.42
193 0.48
194 0.53
195 0.53
196 0.59
197 0.61
198 0.64
199 0.65
200 0.59
201 0.54
202 0.45
203 0.38
204 0.31
205 0.25
206 0.18
207 0.16
208 0.16
209 0.16
210 0.22
211 0.24
212 0.22
213 0.22
214 0.25
215 0.27
216 0.31
217 0.33
218 0.32
219 0.38
220 0.41
221 0.46
222 0.44
223 0.42
224 0.38
225 0.33
226 0.28
227 0.21
228 0.19
229 0.13
230 0.12
231 0.11
232 0.1
233 0.11
234 0.1
235 0.11
236 0.12
237 0.12
238 0.12
239 0.13
240 0.13
241 0.15
242 0.15
243 0.14
244 0.13
245 0.14