Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167XUZ8

Protein Details
Accession A0A167XUZ8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-40YPSAKTRKYNWSEKAKRRKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MGGVGRRALHIQKHECAACGYPSAKTRKYNWSEKAKRRKTTGTGRCRYLKDVSRRFQNDFQTGTPKGARGPSSKSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.38
4 0.33
5 0.26
6 0.24
7 0.21
8 0.18
9 0.24
10 0.29
11 0.32
12 0.35
13 0.38
14 0.45
15 0.51
16 0.56
17 0.59
18 0.64
19 0.69
20 0.74
21 0.81
22 0.79
23 0.78
24 0.74
25 0.71
26 0.67
27 0.68
28 0.68
29 0.68
30 0.64
31 0.64
32 0.65
33 0.61
34 0.58
35 0.54
36 0.52
37 0.52
38 0.56
39 0.57
40 0.61
41 0.63
42 0.65
43 0.64
44 0.64
45 0.58
46 0.52
47 0.49
48 0.45
49 0.42
50 0.4
51 0.36
52 0.29
53 0.27
54 0.3
55 0.32
56 0.29