Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0WC50

Protein Details
Accession G0WC50    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-42EIKSEINKRKKKTLKNLKKTIVRKGBasic
63-82EVTVMKSKDKWLKRRALNRKHydrophilic
NLS Segment(s)
PositionSequence
25-40KRKKKTLKNLKKTIVR
68-82KSKDKWLKRRALNRK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013268  U3_snoRNA_assoc  
Gene Ontology GO:0030515  F:snoRNA binding  
GO:0006364  P:rRNA processing  
KEGG ndi:NDAI_0F00420  -  
Pfam View protein in Pfam  
PF08297  U3_snoRNA_assoc  
Amino Acid Sequences MPKRINFNEIDPSEYSLEIKSEINKRKKKTLKNLKKTIVRKGPVTVSLLSSTNESRSLAPKREVTVMKSKDKWLKRRALNRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.17
4 0.16
5 0.14
6 0.14
7 0.16
8 0.24
9 0.33
10 0.42
11 0.49
12 0.53
13 0.62
14 0.7
15 0.74
16 0.77
17 0.79
18 0.8
19 0.83
20 0.88
21 0.86
22 0.86
23 0.81
24 0.79
25 0.76
26 0.67
27 0.58
28 0.51
29 0.44
30 0.37
31 0.35
32 0.26
33 0.19
34 0.18
35 0.17
36 0.15
37 0.15
38 0.14
39 0.12
40 0.13
41 0.12
42 0.12
43 0.18
44 0.23
45 0.26
46 0.3
47 0.31
48 0.33
49 0.39
50 0.4
51 0.38
52 0.43
53 0.45
54 0.49
55 0.49
56 0.55
57 0.57
58 0.64
59 0.68
60 0.68
61 0.72
62 0.73