Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JRQ6

Protein Details
Accession I2JRQ6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPTTHLRRQRKIMKKNNELNSPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041243  STI1/HOP_DP  
IPR006636  STI1_HS-bd  
Pfam View protein in Pfam  
PF17830  STI1  
Amino Acid Sequences MPTTHLRRQRKIMKKNNELNSPQMNEIYQLSQKALTQRFAPMDGETYEETMKRVQKDPEVIEIMSDPVMQTILQQAQSNPAALQEHMKNPEVYRKITILMAAGIIRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.86
5 0.78
6 0.73
7 0.69
8 0.61
9 0.52
10 0.43
11 0.34
12 0.27
13 0.26
14 0.22
15 0.17
16 0.15
17 0.14
18 0.14
19 0.16
20 0.21
21 0.22
22 0.21
23 0.2
24 0.22
25 0.23
26 0.23
27 0.23
28 0.16
29 0.16
30 0.14
31 0.16
32 0.13
33 0.13
34 0.12
35 0.11
36 0.11
37 0.13
38 0.15
39 0.15
40 0.18
41 0.19
42 0.21
43 0.25
44 0.26
45 0.27
46 0.26
47 0.23
48 0.2
49 0.19
50 0.16
51 0.12
52 0.1
53 0.06
54 0.04
55 0.05
56 0.04
57 0.04
58 0.07
59 0.09
60 0.1
61 0.11
62 0.11
63 0.16
64 0.17
65 0.17
66 0.14
67 0.14
68 0.14
69 0.14
70 0.18
71 0.17
72 0.22
73 0.25
74 0.27
75 0.27
76 0.27
77 0.37
78 0.35
79 0.35
80 0.33
81 0.31
82 0.31
83 0.3
84 0.29
85 0.21
86 0.18
87 0.16
88 0.13