Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162IUC8

Protein Details
Accession A0A162IUC8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-44NAPAAGAKKQKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
22-39AGAKKQKKKWSKGKVKDK
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVRRSSHAARPAYSRSDNAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKATSEKLYKDVQSYRLVTVAVLVDRMKVNGSLARQCLNDLEEKGLIKPVVSHSKMKIYTRAVGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.41
4 0.39
5 0.33
6 0.31
7 0.26
8 0.26
9 0.29
10 0.32
11 0.34
12 0.42
13 0.49
14 0.56
15 0.65
16 0.72
17 0.78
18 0.82
19 0.85
20 0.86
21 0.9
22 0.91
23 0.91
24 0.88
25 0.83
26 0.78
27 0.69
28 0.61
29 0.51
30 0.43
31 0.34
32 0.28
33 0.21
34 0.15
35 0.13
36 0.11
37 0.1
38 0.09
39 0.08
40 0.1
41 0.12
42 0.13
43 0.16
44 0.18
45 0.2
46 0.24
47 0.25
48 0.22
49 0.21
50 0.2
51 0.16
52 0.15
53 0.12
54 0.08
55 0.08
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.1
64 0.13
65 0.16
66 0.17
67 0.2
68 0.19
69 0.2
70 0.2
71 0.19
72 0.2
73 0.17
74 0.18
75 0.17
76 0.18
77 0.18
78 0.2
79 0.18
80 0.15
81 0.16
82 0.2
83 0.28
84 0.31
85 0.34
86 0.34
87 0.43
88 0.49
89 0.5
90 0.5
91 0.45
92 0.48