Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166V4Q0

Protein Details
Accession A0A166V4Q0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
177-200GYQDRRGRRGCQDRRDRRDSQDRRBasic
203-224QDLLDRRDRRDRQDRRDHAGDQBasic
NLS Segment(s)
PositionSequence
91-113RPKCRERGGSQGPKVSKVSKVPK
Subcellular Location(s) cyto 8, extr 8, cyto_nucl 6, E.R. 4, nucl 2, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKEAGDHFVTMTLRASSCNTIVTVLLGITSASPPPSQPQAAPPPTTQPQQNAVAGASQSGLSEGNAVLLGVLLGLAVVSAILIALCCLRKRPKCRERGGSQGPKVSKVSKVPKVTKVNKVNKVLKVNKVNKVNKVNKVTKGFAAVQGLKVRWDIRVNRGLRVAEGLRECRVRQANLGYQDRRGRRGCQDRRDRRDSQDRRGLQDLLDRRDRRDRQDRRDHAGDQVSGLQKIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.18
4 0.18
5 0.19
6 0.17
7 0.16
8 0.16
9 0.15
10 0.12
11 0.09
12 0.08
13 0.07
14 0.06
15 0.06
16 0.07
17 0.07
18 0.08
19 0.08
20 0.09
21 0.13
22 0.18
23 0.19
24 0.2
25 0.26
26 0.35
27 0.39
28 0.42
29 0.39
30 0.41
31 0.43
32 0.46
33 0.41
34 0.35
35 0.36
36 0.37
37 0.36
38 0.3
39 0.26
40 0.24
41 0.21
42 0.17
43 0.12
44 0.08
45 0.07
46 0.07
47 0.07
48 0.05
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.01
63 0.01
64 0.01
65 0.01
66 0.01
67 0.01
68 0.01
69 0.02
70 0.02
71 0.04
72 0.05
73 0.05
74 0.1
75 0.19
76 0.27
77 0.35
78 0.47
79 0.54
80 0.63
81 0.72
82 0.76
83 0.73
84 0.76
85 0.78
86 0.75
87 0.69
88 0.65
89 0.57
90 0.5
91 0.47
92 0.38
93 0.31
94 0.3
95 0.35
96 0.37
97 0.44
98 0.46
99 0.53
100 0.61
101 0.63
102 0.65
103 0.68
104 0.69
105 0.69
106 0.73
107 0.7
108 0.65
109 0.69
110 0.64
111 0.61
112 0.62
113 0.61
114 0.6
115 0.64
116 0.62
117 0.61
118 0.66
119 0.66
120 0.64
121 0.66
122 0.64
123 0.61
124 0.62
125 0.56
126 0.47
127 0.44
128 0.37
129 0.31
130 0.3
131 0.24
132 0.22
133 0.24
134 0.23
135 0.19
136 0.2
137 0.18
138 0.16
139 0.21
140 0.22
141 0.25
142 0.34
143 0.34
144 0.35
145 0.38
146 0.36
147 0.3
148 0.31
149 0.25
150 0.21
151 0.23
152 0.22
153 0.22
154 0.24
155 0.24
156 0.27
157 0.31
158 0.28
159 0.29
160 0.33
161 0.36
162 0.42
163 0.5
164 0.44
165 0.46
166 0.52
167 0.52
168 0.52
169 0.49
170 0.46
171 0.49
172 0.59
173 0.62
174 0.65
175 0.73
176 0.77
177 0.83
178 0.86
179 0.81
180 0.79
181 0.8
182 0.78
183 0.76
184 0.75
185 0.7
186 0.68
187 0.68
188 0.59
189 0.49
190 0.5
191 0.47
192 0.44
193 0.5
194 0.45
195 0.46
196 0.56
197 0.6
198 0.61
199 0.65
200 0.69
201 0.69
202 0.79
203 0.82
204 0.8
205 0.81
206 0.73
207 0.7
208 0.66
209 0.56
210 0.46
211 0.46
212 0.4