Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167YUY5

Protein Details
Accession A0A167YUY5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-74FIHYATMKPEQKKKKKTKKGADNAKSSAGHydrophilic
NLS Segment(s)
PositionSequence
55-76EQKKKKKTKKGADNAKSSAGRK
Subcellular Location(s) cyto 6extr 6, E.R. 5, golg 4, mito 3, cyto_nucl 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANFDWLAKIGATREAVAVLNDQNFLFVDLIVVLVGLGLQCTLIWFIHYATMKPEQKKKKKTKKGADNAKSSAGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.13
5 0.14
6 0.12
7 0.11
8 0.12
9 0.11
10 0.1
11 0.1
12 0.11
13 0.09
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.04
20 0.03
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.05
33 0.05
34 0.1
35 0.11
36 0.11
37 0.13
38 0.22
39 0.28
40 0.33
41 0.42
42 0.49
43 0.59
44 0.7
45 0.78
46 0.8
47 0.86
48 0.91
49 0.93
50 0.94
51 0.94
52 0.95
53 0.92
54 0.89
55 0.82
56 0.79