Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166UQX1

Protein Details
Accession A0A166UQX1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-117AARKEKIDRIREKRAKKEERERYEKMAETMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
26-113WHAPKKAFRPTRGLTSYEKRTKERNAMAQMKAKEKEMKDEKEAARKEKIDRIREKRAKKEERERYEKMAETMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSDEQLALVAAEDTEKTAKPLGKQWHAPKKAFRPTRGLTSYEKRTKERNAMAQMKAKEKEMKDEKEAARKEKIDRIREKRAKKEERERYEKMAETMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.1
5 0.14
6 0.17
7 0.19
8 0.27
9 0.34
10 0.4
11 0.48
12 0.57
13 0.63
14 0.67
15 0.69
16 0.69
17 0.7
18 0.73
19 0.72
20 0.65
21 0.63
22 0.59
23 0.64
24 0.58
25 0.52
26 0.48
27 0.48
28 0.54
29 0.53
30 0.54
31 0.47
32 0.5
33 0.52
34 0.54
35 0.52
36 0.5
37 0.52
38 0.54
39 0.54
40 0.55
41 0.52
42 0.49
43 0.44
44 0.38
45 0.34
46 0.29
47 0.35
48 0.36
49 0.37
50 0.35
51 0.42
52 0.42
53 0.45
54 0.48
55 0.42
56 0.4
57 0.4
58 0.4
59 0.4
60 0.46
61 0.47
62 0.54
63 0.58
64 0.64
65 0.7
66 0.75
67 0.77
68 0.8
69 0.81
70 0.8
71 0.83
72 0.83
73 0.84
74 0.85
75 0.79
76 0.75
77 0.71
78 0.63
79 0.54
80 0.49
81 0.45
82 0.46
83 0.49
84 0.52
85 0.52
86 0.52
87 0.58
88 0.62
89 0.68
90 0.69
91 0.73
92 0.76
93 0.79
94 0.89
95 0.92
96 0.93
97 0.93