Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162IM78

Protein Details
Accession A0A162IM78    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
283-309ALETWWRRIRKAAKKSRMARHIPDDYRHydrophilic
NLS Segment(s)
PositionSequence
289-302RRIRKAAKKSRMAR
Subcellular Location(s) plas 9, mito 6, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKHYNFGVEIETVGKPYGGGESFTNVDWYRQLAQKLRNRGIDAVHDECSRYSKHPEYYGGKWLTGSFLKVCMEVVSPRLDTKLHVSRILSDFWEGMSVHFNPQRDASCGGHVHVTPVRRGNKFKLSSLKKIAFAAIVYEDFVSSIQAPCRRDNKFCKPNSQSGDSGLCDTLSRGSLWGVQKSTASLTHVAHEIKRLPCEADLYLYMQGDRYVLWNFQNIVPHPKTGRCTGTVEFRGGNQFLSTKGTLAWVGFVLGFITLALKENLLKRFARYISPLDADFTAALETWWRRIRKAAKKSRMARHIPDDYRKMASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.1
4 0.14
5 0.12
6 0.13
7 0.13
8 0.16
9 0.18
10 0.18
11 0.22
12 0.18
13 0.18
14 0.18
15 0.2
16 0.21
17 0.24
18 0.3
19 0.33
20 0.42
21 0.48
22 0.57
23 0.61
24 0.62
25 0.6
26 0.57
27 0.52
28 0.5
29 0.49
30 0.42
31 0.38
32 0.33
33 0.31
34 0.29
35 0.3
36 0.25
37 0.23
38 0.27
39 0.3
40 0.35
41 0.38
42 0.46
43 0.48
44 0.49
45 0.55
46 0.49
47 0.43
48 0.38
49 0.34
50 0.3
51 0.25
52 0.24
53 0.15
54 0.16
55 0.17
56 0.16
57 0.16
58 0.13
59 0.14
60 0.13
61 0.14
62 0.14
63 0.14
64 0.15
65 0.16
66 0.15
67 0.15
68 0.21
69 0.27
70 0.27
71 0.29
72 0.29
73 0.32
74 0.34
75 0.34
76 0.27
77 0.2
78 0.18
79 0.15
80 0.17
81 0.12
82 0.1
83 0.12
84 0.12
85 0.15
86 0.18
87 0.18
88 0.17
89 0.2
90 0.21
91 0.2
92 0.23
93 0.2
94 0.22
95 0.22
96 0.22
97 0.22
98 0.2
99 0.2
100 0.19
101 0.19
102 0.17
103 0.24
104 0.29
105 0.31
106 0.35
107 0.37
108 0.45
109 0.46
110 0.48
111 0.51
112 0.51
113 0.54
114 0.57
115 0.55
116 0.47
117 0.45
118 0.4
119 0.31
120 0.24
121 0.19
122 0.12
123 0.09
124 0.08
125 0.07
126 0.06
127 0.06
128 0.06
129 0.05
130 0.05
131 0.06
132 0.09
133 0.13
134 0.15
135 0.2
136 0.26
137 0.28
138 0.35
139 0.42
140 0.5
141 0.56
142 0.56
143 0.61
144 0.59
145 0.64
146 0.61
147 0.57
148 0.46
149 0.4
150 0.4
151 0.3
152 0.27
153 0.19
154 0.15
155 0.11
156 0.11
157 0.09
158 0.07
159 0.07
160 0.06
161 0.06
162 0.11
163 0.13
164 0.15
165 0.15
166 0.15
167 0.15
168 0.15
169 0.16
170 0.12
171 0.12
172 0.12
173 0.12
174 0.13
175 0.16
176 0.16
177 0.15
178 0.17
179 0.21
180 0.2
181 0.21
182 0.2
183 0.19
184 0.18
185 0.2
186 0.18
187 0.14
188 0.13
189 0.14
190 0.14
191 0.13
192 0.13
193 0.1
194 0.1
195 0.08
196 0.08
197 0.08
198 0.08
199 0.09
200 0.1
201 0.13
202 0.14
203 0.16
204 0.21
205 0.2
206 0.27
207 0.27
208 0.29
209 0.29
210 0.31
211 0.33
212 0.33
213 0.34
214 0.29
215 0.32
216 0.31
217 0.38
218 0.36
219 0.35
220 0.31
221 0.29
222 0.3
223 0.26
224 0.24
225 0.16
226 0.14
227 0.13
228 0.17
229 0.16
230 0.13
231 0.13
232 0.14
233 0.13
234 0.13
235 0.13
236 0.08
237 0.08
238 0.08
239 0.08
240 0.06
241 0.05
242 0.05
243 0.04
244 0.05
245 0.05
246 0.06
247 0.07
248 0.07
249 0.1
250 0.16
251 0.19
252 0.22
253 0.23
254 0.24
255 0.31
256 0.33
257 0.34
258 0.33
259 0.35
260 0.36
261 0.38
262 0.36
263 0.31
264 0.29
265 0.26
266 0.22
267 0.17
268 0.12
269 0.1
270 0.09
271 0.12
272 0.13
273 0.19
274 0.26
275 0.27
276 0.28
277 0.37
278 0.48
279 0.53
280 0.64
281 0.68
282 0.71
283 0.8
284 0.89
285 0.9
286 0.9
287 0.87
288 0.84
289 0.82
290 0.82
291 0.8
292 0.79
293 0.74
294 0.68