Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167Y137

Protein Details
Accession A0A167Y137    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
364-391VSEAASKKKPPPPPAKKKPQLNGPSNTSHydrophilic
NLS Segment(s)
PositionSequence
369-382SKKKPPPPPAKKKP
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSGGFKDIVKNGWHPEKSGGIRGSVNGFMGRNKDSASSTSSTHVSRPLSDLKDASQFAPPPKRTGTGLAPPPAPVAEKRKVITSPSKYADPRAEEVDQPHVGHVDESRQASTGLDHGAASRPYRMNTTGLSTQNLPKPPTRRDDADGSTPPPYTEAPRKTAAAPKALPPSLPPRLPPRNVSGSGASLNAGAVNRLGTAGVSVPALGIGRGSTDVAAPASQPSPTTGSGKWGAQVNELQGKFANLRTSSSSSLTPAAQDQAPTTPSSQGTTWAQKQAALKTASNFHKDPSSVSFSDAKSAATTANNFRQRHGDQIATGVKTANSLNQKYGWADKVNAGISSQSSAPPPLPGPSQLYIGAKTSNTVSEAASKKKPPPPPAKKKPQLNGPSNTSANPGLEPPPIPISTRPTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.47
4 0.47
5 0.5
6 0.44
7 0.37
8 0.37
9 0.37
10 0.37
11 0.29
12 0.27
13 0.21
14 0.21
15 0.21
16 0.24
17 0.24
18 0.22
19 0.22
20 0.23
21 0.23
22 0.24
23 0.26
24 0.24
25 0.24
26 0.26
27 0.28
28 0.26
29 0.26
30 0.29
31 0.26
32 0.26
33 0.29
34 0.34
35 0.34
36 0.36
37 0.35
38 0.32
39 0.37
40 0.36
41 0.33
42 0.31
43 0.31
44 0.36
45 0.45
46 0.44
47 0.41
48 0.43
49 0.44
50 0.41
51 0.43
52 0.42
53 0.4
54 0.45
55 0.45
56 0.42
57 0.4
58 0.39
59 0.34
60 0.29
61 0.26
62 0.27
63 0.29
64 0.33
65 0.34
66 0.37
67 0.38
68 0.42
69 0.47
70 0.47
71 0.48
72 0.47
73 0.53
74 0.5
75 0.53
76 0.53
77 0.48
78 0.43
79 0.4
80 0.38
81 0.34
82 0.35
83 0.36
84 0.31
85 0.27
86 0.25
87 0.2
88 0.18
89 0.17
90 0.16
91 0.13
92 0.15
93 0.16
94 0.16
95 0.16
96 0.16
97 0.16
98 0.16
99 0.13
100 0.11
101 0.1
102 0.09
103 0.09
104 0.12
105 0.14
106 0.14
107 0.17
108 0.18
109 0.18
110 0.21
111 0.22
112 0.21
113 0.21
114 0.25
115 0.26
116 0.26
117 0.27
118 0.26
119 0.29
120 0.32
121 0.35
122 0.32
123 0.32
124 0.37
125 0.4
126 0.44
127 0.44
128 0.43
129 0.43
130 0.47
131 0.45
132 0.45
133 0.42
134 0.38
135 0.35
136 0.31
137 0.27
138 0.22
139 0.2
140 0.18
141 0.24
142 0.26
143 0.28
144 0.3
145 0.32
146 0.32
147 0.38
148 0.36
149 0.33
150 0.31
151 0.31
152 0.35
153 0.34
154 0.31
155 0.27
156 0.32
157 0.31
158 0.3
159 0.28
160 0.31
161 0.39
162 0.41
163 0.42
164 0.4
165 0.41
166 0.41
167 0.41
168 0.33
169 0.27
170 0.25
171 0.22
172 0.17
173 0.11
174 0.09
175 0.08
176 0.07
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.04
186 0.04
187 0.04
188 0.04
189 0.03
190 0.04
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.05
203 0.05
204 0.05
205 0.06
206 0.06
207 0.06
208 0.07
209 0.1
210 0.11
211 0.14
212 0.13
213 0.16
214 0.18
215 0.18
216 0.19
217 0.2
218 0.19
219 0.18
220 0.19
221 0.17
222 0.22
223 0.22
224 0.2
225 0.16
226 0.17
227 0.16
228 0.17
229 0.19
230 0.12
231 0.14
232 0.18
233 0.21
234 0.22
235 0.22
236 0.21
237 0.19
238 0.2
239 0.18
240 0.15
241 0.13
242 0.13
243 0.12
244 0.12
245 0.11
246 0.11
247 0.12
248 0.12
249 0.13
250 0.13
251 0.13
252 0.15
253 0.14
254 0.16
255 0.19
256 0.24
257 0.26
258 0.28
259 0.28
260 0.29
261 0.32
262 0.31
263 0.34
264 0.31
265 0.29
266 0.27
267 0.35
268 0.36
269 0.38
270 0.35
271 0.3
272 0.31
273 0.3
274 0.3
275 0.27
276 0.29
277 0.25
278 0.28
279 0.31
280 0.28
281 0.31
282 0.29
283 0.24
284 0.18
285 0.18
286 0.16
287 0.13
288 0.16
289 0.19
290 0.27
291 0.35
292 0.35
293 0.36
294 0.42
295 0.41
296 0.45
297 0.43
298 0.36
299 0.29
300 0.35
301 0.38
302 0.31
303 0.3
304 0.23
305 0.2
306 0.19
307 0.19
308 0.19
309 0.22
310 0.23
311 0.24
312 0.25
313 0.27
314 0.28
315 0.32
316 0.3
317 0.25
318 0.26
319 0.26
320 0.28
321 0.28
322 0.26
323 0.22
324 0.18
325 0.17
326 0.17
327 0.15
328 0.12
329 0.12
330 0.14
331 0.14
332 0.15
333 0.16
334 0.17
335 0.18
336 0.2
337 0.24
338 0.24
339 0.26
340 0.27
341 0.28
342 0.26
343 0.26
344 0.25
345 0.2
346 0.19
347 0.18
348 0.16
349 0.16
350 0.16
351 0.15
352 0.21
353 0.26
354 0.31
355 0.37
356 0.4
357 0.47
358 0.54
359 0.62
360 0.64
361 0.7
362 0.75
363 0.8
364 0.86
365 0.89
366 0.91
367 0.93
368 0.91
369 0.9
370 0.89
371 0.87
372 0.84
373 0.8
374 0.77
375 0.69
376 0.61
377 0.54
378 0.45
379 0.38
380 0.31
381 0.26
382 0.22
383 0.23
384 0.23
385 0.23
386 0.26
387 0.26
388 0.27
389 0.29