Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JWN9

Protein Details
Accession I2JWN9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNLQRMRTRRLCKRPKEGDDDEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR000996  Clathrin_L-chain  
Gene Ontology GO:0030132  C:clathrin coat of coated pit  
GO:0030130  C:clathrin coat of trans-Golgi network vesicle  
GO:0005198  F:structural molecule activity  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF01086  Clathrin_lg_ch  
Amino Acid Sequences MNLQRMRTRRLCKRPKEGDDDEFQDFKTQFPAVDSQASETVAADKETXKXEAXESDDLNEGTAAVTKKFDSLNMEESEPVKEWKQKKEAEITEKDEADAKKLQGLKEDAQKATDEFYENYNNKKDVLIEQTKKEEKKFLEKRDSFLEKGTVWDHAIELLKLNKNSSSVDDENHRDKTRFKEIFTFFKRKRNSSRCSGGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.87
4 0.83
5 0.78
6 0.74
7 0.68
8 0.62
9 0.52
10 0.44
11 0.4
12 0.33
13 0.28
14 0.24
15 0.2
16 0.16
17 0.18
18 0.21
19 0.17
20 0.21
21 0.2
22 0.2
23 0.21
24 0.21
25 0.18
26 0.15
27 0.15
28 0.12
29 0.13
30 0.11
31 0.1
32 0.12
33 0.12
34 0.12
35 0.11
36 0.11
37 0.12
38 0.12
39 0.14
40 0.15
41 0.14
42 0.14
43 0.13
44 0.12
45 0.1
46 0.12
47 0.1
48 0.08
49 0.09
50 0.09
51 0.11
52 0.11
53 0.13
54 0.14
55 0.16
56 0.2
57 0.21
58 0.21
59 0.21
60 0.21
61 0.21
62 0.18
63 0.17
64 0.14
65 0.19
66 0.23
67 0.29
68 0.36
69 0.37
70 0.4
71 0.47
72 0.5
73 0.51
74 0.51
75 0.49
76 0.45
77 0.41
78 0.38
79 0.34
80 0.28
81 0.24
82 0.21
83 0.16
84 0.17
85 0.19
86 0.19
87 0.18
88 0.22
89 0.21
90 0.26
91 0.3
92 0.27
93 0.25
94 0.25
95 0.22
96 0.2
97 0.18
98 0.13
99 0.1
100 0.12
101 0.19
102 0.2
103 0.23
104 0.24
105 0.24
106 0.23
107 0.22
108 0.21
109 0.17
110 0.24
111 0.3
112 0.3
113 0.33
114 0.39
115 0.45
116 0.46
117 0.44
118 0.43
119 0.37
120 0.45
121 0.51
122 0.52
123 0.58
124 0.57
125 0.59
126 0.61
127 0.63
128 0.53
129 0.46
130 0.4
131 0.29
132 0.3
133 0.28
134 0.21
135 0.16
136 0.16
137 0.14
138 0.13
139 0.14
140 0.12
141 0.14
142 0.18
143 0.22
144 0.23
145 0.24
146 0.22
147 0.23
148 0.24
149 0.25
150 0.28
151 0.24
152 0.26
153 0.31
154 0.35
155 0.39
156 0.44
157 0.44
158 0.38
159 0.41
160 0.46
161 0.51
162 0.49
163 0.46
164 0.5
165 0.52
166 0.61
167 0.64
168 0.67
169 0.61
170 0.66
171 0.71
172 0.7
173 0.76
174 0.75
175 0.74
176 0.73