Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JU62

Protein Details
Accession I2JU62    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-50MPRLSQKERKRRAATSKLRSHydrophilic
NLS Segment(s)
PositionSequence
37-49KERKRRAATSKLR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MPTLGDAIRKASESESGNSNVSSKTGGSTFMPRLSQKERKRRAATSKLRSNDNRDGKPAKPVSAPWTKGSTWNAVSPEELPALDVSVTKVGTSTRKSSVGIDTRFSRGNVWGSITPDVSDKTSGKAVTSFDSVLFEEKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.26
5 0.25
6 0.25
7 0.2
8 0.17
9 0.16
10 0.12
11 0.11
12 0.11
13 0.12
14 0.13
15 0.18
16 0.2
17 0.22
18 0.25
19 0.24
20 0.29
21 0.36
22 0.44
23 0.48
24 0.57
25 0.63
26 0.7
27 0.75
28 0.77
29 0.79
30 0.8
31 0.81
32 0.8
33 0.79
34 0.72
35 0.74
36 0.7
37 0.67
38 0.66
39 0.64
40 0.56
41 0.52
42 0.53
43 0.46
44 0.51
45 0.44
46 0.36
47 0.29
48 0.29
49 0.3
50 0.34
51 0.35
52 0.29
53 0.31
54 0.29
55 0.32
56 0.32
57 0.29
58 0.23
59 0.23
60 0.22
61 0.19
62 0.19
63 0.16
64 0.15
65 0.12
66 0.1
67 0.08
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.06
74 0.07
75 0.06
76 0.06
77 0.08
78 0.12
79 0.15
80 0.18
81 0.2
82 0.22
83 0.23
84 0.25
85 0.31
86 0.34
87 0.33
88 0.33
89 0.33
90 0.34
91 0.35
92 0.33
93 0.27
94 0.23
95 0.24
96 0.21
97 0.23
98 0.23
99 0.24
100 0.25
101 0.24
102 0.21
103 0.2
104 0.2
105 0.18
106 0.19
107 0.17
108 0.18
109 0.22
110 0.21
111 0.21
112 0.22
113 0.22
114 0.21
115 0.24
116 0.21
117 0.18
118 0.2
119 0.2
120 0.2