Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JTA2

Protein Details
Accession I2JTA2    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-42GSLLWKRPWRLSKTQKFRQRKRLQQVDENIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGPFRATLVDMGSLLWKRPWRLSKTQKFRQRKRLQQVDENIENLYEGMKSNGMSAKSIDHLMFEFPKEKDMEPKDKYTVFDKHSKGYRKAIHFVPKWTKISLRKNPKNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.18
4 0.21
5 0.22
6 0.31
7 0.39
8 0.42
9 0.52
10 0.62
11 0.68
12 0.75
13 0.82
14 0.85
15 0.87
16 0.89
17 0.9
18 0.89
19 0.89
20 0.89
21 0.9
22 0.85
23 0.82
24 0.8
25 0.76
26 0.67
27 0.57
28 0.46
29 0.36
30 0.3
31 0.21
32 0.14
33 0.07
34 0.05
35 0.05
36 0.05
37 0.06
38 0.07
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.1
45 0.11
46 0.1
47 0.08
48 0.08
49 0.09
50 0.1
51 0.1
52 0.13
53 0.12
54 0.14
55 0.15
56 0.16
57 0.22
58 0.27
59 0.35
60 0.35
61 0.39
62 0.4
63 0.4
64 0.42
65 0.39
66 0.4
67 0.36
68 0.41
69 0.39
70 0.42
71 0.48
72 0.54
73 0.53
74 0.56
75 0.59
76 0.57
77 0.6
78 0.61
79 0.63
80 0.59
81 0.63
82 0.64
83 0.63
84 0.6
85 0.58
86 0.59
87 0.58
88 0.66
89 0.67
90 0.69