Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K1J7

Protein Details
Accession I2K1J7   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
199-218VKEGQIVIKKKPKKHRRSRKBasic
NLS Segment(s)
PositionSequence
210-221KKKPKKHRRSRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, cyto 5, cyto_pero 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001607  Znf_UBP  
Gene Ontology GO:0016874  F:ligase activity  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50271  ZF_UBP  
Amino Acid Sequences MEITTQRVWDYSGDNYVHRLVQSEVDGKYLELPIRDKPHKGFLGXDDDDYEDDEDEGDEEDEAKEAKIEKIGLEYSNMLISQLESQREFYDSKFAEVQNKFNLANQNLVSVKKTLGGLKEKLEKVSEDYRACKKVDPKELSDXKRKYEDEKSLNKAFMEKLSFLTSQNSELQXKNKDLEDQVRDLMFYLDTQSKLKDAPEEVKEGQIVIKKKPKKHRRSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.25
5 0.22
6 0.22
7 0.17
8 0.18
9 0.21
10 0.23
11 0.21
12 0.21
13 0.21
14 0.19
15 0.2
16 0.2
17 0.18
18 0.16
19 0.18
20 0.23
21 0.32
22 0.35
23 0.37
24 0.38
25 0.45
26 0.46
27 0.45
28 0.41
29 0.36
30 0.41
31 0.37
32 0.34
33 0.28
34 0.25
35 0.24
36 0.22
37 0.18
38 0.09
39 0.09
40 0.09
41 0.06
42 0.06
43 0.06
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.08
52 0.08
53 0.1
54 0.1
55 0.1
56 0.12
57 0.13
58 0.13
59 0.13
60 0.13
61 0.11
62 0.11
63 0.11
64 0.08
65 0.07
66 0.07
67 0.1
68 0.12
69 0.13
70 0.13
71 0.14
72 0.14
73 0.16
74 0.17
75 0.13
76 0.18
77 0.17
78 0.18
79 0.2
80 0.2
81 0.26
82 0.27
83 0.29
84 0.24
85 0.26
86 0.24
87 0.24
88 0.28
89 0.21
90 0.23
91 0.2
92 0.2
93 0.19
94 0.2
95 0.18
96 0.14
97 0.13
98 0.11
99 0.12
100 0.11
101 0.14
102 0.18
103 0.19
104 0.21
105 0.28
106 0.27
107 0.28
108 0.27
109 0.24
110 0.24
111 0.27
112 0.29
113 0.24
114 0.28
115 0.32
116 0.34
117 0.34
118 0.34
119 0.36
120 0.38
121 0.46
122 0.46
123 0.46
124 0.55
125 0.63
126 0.67
127 0.68
128 0.62
129 0.55
130 0.58
131 0.57
132 0.51
133 0.52
134 0.52
135 0.52
136 0.56
137 0.57
138 0.5
139 0.47
140 0.44
141 0.35
142 0.3
143 0.26
144 0.2
145 0.19
146 0.21
147 0.22
148 0.21
149 0.23
150 0.2
151 0.2
152 0.25
153 0.26
154 0.25
155 0.3
156 0.33
157 0.36
158 0.37
159 0.35
160 0.35
161 0.37
162 0.37
163 0.38
164 0.36
165 0.32
166 0.3
167 0.28
168 0.24
169 0.2
170 0.17
171 0.11
172 0.13
173 0.14
174 0.15
175 0.17
176 0.17
177 0.17
178 0.18
179 0.19
180 0.2
181 0.21
182 0.27
183 0.29
184 0.34
185 0.34
186 0.35
187 0.34
188 0.3
189 0.29
190 0.28
191 0.28
192 0.3
193 0.39
194 0.45
195 0.54
196 0.65
197 0.72
198 0.78