Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162IP95

Protein Details
Accession A0A162IP95   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
266-286VIEKKPSKGSGRKQFPHRIAEHydrophilic
NLS Segment(s)
PositionSequence
270-276KPSKGSG
301-327KRKQVHKLGTAARANIGSRKLKTKKKM
Subcellular Location(s) cyto 11, cyto_nucl 10, pero 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000235  Ribosomal_S5/S7  
IPR023798  Ribosomal_S7_dom  
IPR036823  Ribosomal_S7_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00177  Ribosomal_S7  
Amino Acid Sequences MQKLDDVLKAHRQRPPAGPDASEQSEKNISAASNSKTKDAVNGSSEPSTVPELSHVSHDSPIDALDDATLEQILYGGRPATSQQTGGLTAAQEDALYREGTIPSPDEAEVSVGSPERVTANSIQPAQAGDIRNPGLKFDLPKKPYPEGFQMKQRYHPVLEQLTRLLMRDGKLSVAQRNVAMVMNFLRTAPAPIYSPKFPLLPGTPPASHLPLNPVLYITIAIDSVAPLLRVRNIAGAGGGGRALELPVPLAIRQRRREAIKWILDVIEKKPSKGSGRKQFPHRIAEEIIAVVEGRSGVWEKRKQVHKLGTAARANIGSRKLKTKKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.58
4 0.54
5 0.49
6 0.48
7 0.5
8 0.49
9 0.44
10 0.37
11 0.33
12 0.34
13 0.32
14 0.29
15 0.24
16 0.19
17 0.2
18 0.25
19 0.25
20 0.28
21 0.29
22 0.3
23 0.3
24 0.3
25 0.32
26 0.31
27 0.32
28 0.3
29 0.31
30 0.33
31 0.32
32 0.32
33 0.25
34 0.23
35 0.21
36 0.17
37 0.15
38 0.14
39 0.15
40 0.16
41 0.19
42 0.19
43 0.17
44 0.19
45 0.19
46 0.17
47 0.15
48 0.15
49 0.12
50 0.11
51 0.09
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.05
58 0.04
59 0.05
60 0.05
61 0.04
62 0.05
63 0.05
64 0.05
65 0.06
66 0.08
67 0.12
68 0.13
69 0.13
70 0.14
71 0.15
72 0.16
73 0.16
74 0.15
75 0.1
76 0.1
77 0.1
78 0.08
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.09
87 0.1
88 0.11
89 0.11
90 0.1
91 0.11
92 0.11
93 0.1
94 0.1
95 0.1
96 0.09
97 0.08
98 0.08
99 0.07
100 0.07
101 0.06
102 0.07
103 0.07
104 0.07
105 0.08
106 0.1
107 0.14
108 0.17
109 0.18
110 0.17
111 0.17
112 0.17
113 0.16
114 0.17
115 0.15
116 0.12
117 0.15
118 0.16
119 0.18
120 0.18
121 0.17
122 0.15
123 0.15
124 0.17
125 0.22
126 0.3
127 0.3
128 0.35
129 0.39
130 0.41
131 0.42
132 0.43
133 0.44
134 0.42
135 0.42
136 0.46
137 0.49
138 0.46
139 0.5
140 0.5
141 0.43
142 0.38
143 0.36
144 0.32
145 0.3
146 0.3
147 0.25
148 0.22
149 0.2
150 0.19
151 0.18
152 0.14
153 0.1
154 0.1
155 0.1
156 0.1
157 0.1
158 0.13
159 0.14
160 0.16
161 0.16
162 0.16
163 0.14
164 0.14
165 0.14
166 0.12
167 0.1
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.07
174 0.07
175 0.08
176 0.08
177 0.08
178 0.08
179 0.11
180 0.15
181 0.16
182 0.18
183 0.18
184 0.18
185 0.17
186 0.19
187 0.19
188 0.18
189 0.2
190 0.22
191 0.21
192 0.23
193 0.25
194 0.24
195 0.22
196 0.19
197 0.21
198 0.21
199 0.22
200 0.2
201 0.18
202 0.15
203 0.15
204 0.15
205 0.1
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.06
216 0.08
217 0.09
218 0.09
219 0.1
220 0.1
221 0.1
222 0.1
223 0.09
224 0.08
225 0.07
226 0.07
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.05
235 0.07
236 0.07
237 0.15
238 0.21
239 0.29
240 0.34
241 0.41
242 0.47
243 0.53
244 0.56
245 0.58
246 0.61
247 0.59
248 0.56
249 0.5
250 0.45
251 0.42
252 0.4
253 0.34
254 0.34
255 0.28
256 0.27
257 0.29
258 0.33
259 0.39
260 0.46
261 0.54
262 0.55
263 0.65
264 0.72
265 0.79
266 0.83
267 0.81
268 0.8
269 0.71
270 0.65
271 0.56
272 0.5
273 0.42
274 0.32
275 0.25
276 0.17
277 0.15
278 0.1
279 0.08
280 0.06
281 0.05
282 0.06
283 0.09
284 0.13
285 0.22
286 0.28
287 0.35
288 0.44
289 0.53
290 0.58
291 0.65
292 0.71
293 0.69
294 0.71
295 0.72
296 0.72
297 0.67
298 0.62
299 0.55
300 0.48
301 0.42
302 0.38
303 0.39
304 0.36
305 0.36
306 0.46
307 0.52