Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JDP3

Protein Details
Accession A0A197JDP3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-37KPTSSSGGKAKKKKWSKGKVKDKANNAVIHydrophilic
NLS Segment(s)
PositionSequence
14-31SGGKAKKKKWSKGKVKDK
Subcellular Location(s) cyto_nucl 9.833, cyto 9.5, nucl 9, mito_nucl 8.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDVAAKPTSSSGGKAKKKKWSKGKVKDKANNAVILDKTTYDKLMKEVPTYKLVSPSVLVDRLRINGSLARAAIRELANQGLIVPVSTHGAQWIYTRATGVEEEKKAAPKKEAADQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.48
4 0.53
5 0.57
6 0.64
7 0.73
8 0.8
9 0.82
10 0.83
11 0.85
12 0.87
13 0.92
14 0.91
15 0.91
16 0.89
17 0.85
18 0.83
19 0.75
20 0.67
21 0.57
22 0.51
23 0.4
24 0.34
25 0.27
26 0.18
27 0.17
28 0.15
29 0.15
30 0.12
31 0.13
32 0.13
33 0.18
34 0.19
35 0.2
36 0.23
37 0.24
38 0.27
39 0.29
40 0.27
41 0.26
42 0.25
43 0.22
44 0.18
45 0.17
46 0.14
47 0.15
48 0.15
49 0.12
50 0.13
51 0.14
52 0.14
53 0.13
54 0.12
55 0.11
56 0.12
57 0.12
58 0.11
59 0.11
60 0.1
61 0.1
62 0.12
63 0.11
64 0.11
65 0.1
66 0.11
67 0.1
68 0.1
69 0.1
70 0.07
71 0.07
72 0.06
73 0.05
74 0.05
75 0.07
76 0.08
77 0.07
78 0.08
79 0.09
80 0.09
81 0.11
82 0.14
83 0.13
84 0.13
85 0.14
86 0.13
87 0.14
88 0.15
89 0.19
90 0.23
91 0.22
92 0.25
93 0.28
94 0.35
95 0.39
96 0.41
97 0.41
98 0.39
99 0.42