Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2K302

Protein Details
Accession I2K302    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-129IDYDSAKKTWKKRCQDSLDKNTEDHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, nucl 8, cyto_nucl 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MSTNEEDLYLQSYPFTTAAAIIGSVDRKVIVNLWDGRTLVGVLRTFDQFGNLVIHDGVERIYLLDKKQYAESEKPRTYLIRGENVVMMVELDIDMEDESLSELTRIDYDSAKKTWKKRCQDSLDKNTEDSTILHDNGMFSAACALY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.08
4 0.08
5 0.09
6 0.08
7 0.08
8 0.06
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.08
15 0.09
16 0.1
17 0.1
18 0.16
19 0.2
20 0.22
21 0.23
22 0.23
23 0.23
24 0.21
25 0.2
26 0.14
27 0.13
28 0.12
29 0.11
30 0.12
31 0.13
32 0.14
33 0.13
34 0.13
35 0.1
36 0.11
37 0.11
38 0.1
39 0.1
40 0.08
41 0.09
42 0.07
43 0.07
44 0.06
45 0.04
46 0.04
47 0.04
48 0.06
49 0.07
50 0.08
51 0.11
52 0.12
53 0.13
54 0.15
55 0.17
56 0.19
57 0.25
58 0.32
59 0.37
60 0.37
61 0.37
62 0.36
63 0.35
64 0.32
65 0.31
66 0.27
67 0.23
68 0.23
69 0.22
70 0.22
71 0.21
72 0.19
73 0.13
74 0.1
75 0.05
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.07
94 0.1
95 0.14
96 0.18
97 0.2
98 0.27
99 0.33
100 0.41
101 0.5
102 0.57
103 0.64
104 0.7
105 0.78
106 0.8
107 0.86
108 0.88
109 0.88
110 0.87
111 0.79
112 0.7
113 0.6
114 0.51
115 0.41
116 0.31
117 0.26
118 0.22
119 0.2
120 0.2
121 0.19
122 0.19
123 0.18
124 0.19
125 0.13
126 0.08