Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JD02

Protein Details
Accession A0A197JD02   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-84DGRIKDDKDRKERTRKSKHLWARKTRLHRKAEEBasic
NLS Segment(s)
PositionSequence
56-81KDDKDRKERTRKSKHLWARKTRLHRK
Subcellular Location(s) mito 15.5, mito_nucl 14, nucl 11.5
Family & Domain DBs
Amino Acid Sequences PTTTQLLLCPVCSQPFKPSKNQNSNLCRHLKNIHNMSPTMHPRKCKWDSIPDGRIKDDKDRKERTRKSKHLWARKTRLHRKAEEATLVLYMLSQAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.41
4 0.48
5 0.57
6 0.63
7 0.71
8 0.77
9 0.77
10 0.76
11 0.78
12 0.76
13 0.72
14 0.62
15 0.55
16 0.54
17 0.5
18 0.51
19 0.52
20 0.51
21 0.47
22 0.46
23 0.44
24 0.45
25 0.46
26 0.45
27 0.41
28 0.39
29 0.39
30 0.48
31 0.49
32 0.48
33 0.44
34 0.45
35 0.5
36 0.55
37 0.6
38 0.55
39 0.53
40 0.49
41 0.48
42 0.4
43 0.43
44 0.43
45 0.44
46 0.48
47 0.55
48 0.62
49 0.71
50 0.78
51 0.8
52 0.83
53 0.84
54 0.83
55 0.84
56 0.86
57 0.86
58 0.86
59 0.86
60 0.85
61 0.84
62 0.87
63 0.87
64 0.87
65 0.84
66 0.78
67 0.76
68 0.74
69 0.7
70 0.63
71 0.53
72 0.45
73 0.37
74 0.33
75 0.24
76 0.16