Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JLW6

Protein Details
Accession A0A197JLW6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32LHHTTRTTKKYHQARRHFVFRKKKNTKELVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLHHTTRTTKKYHQARRHFVFRKKKNTKELVLPDHFLTSYNWEHTWKNCSLHLNDTLRILVMTRRNHIRERVLATESQGKSHSGVGTRHNILQEYSIQKSRLDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.84
4 0.87
5 0.86
6 0.85
7 0.85
8 0.84
9 0.85
10 0.85
11 0.86
12 0.85
13 0.84
14 0.79
15 0.77
16 0.76
17 0.73
18 0.66
19 0.59
20 0.5
21 0.43
22 0.38
23 0.29
24 0.21
25 0.17
26 0.16
27 0.16
28 0.16
29 0.17
30 0.18
31 0.19
32 0.24
33 0.22
34 0.22
35 0.22
36 0.25
37 0.24
38 0.26
39 0.31
40 0.28
41 0.26
42 0.25
43 0.22
44 0.19
45 0.17
46 0.14
47 0.12
48 0.16
49 0.17
50 0.21
51 0.27
52 0.3
53 0.34
54 0.38
55 0.39
56 0.37
57 0.4
58 0.4
59 0.36
60 0.33
61 0.33
62 0.37
63 0.33
64 0.29
65 0.25
66 0.22
67 0.22
68 0.24
69 0.24
70 0.19
71 0.22
72 0.25
73 0.31
74 0.33
75 0.34
76 0.33
77 0.31
78 0.28
79 0.27
80 0.29
81 0.27
82 0.3
83 0.32
84 0.32