Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K0P6

Protein Details
Accession A0A197K0P6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-68HTEERKSKGGQPSQKRRKDRSRSRSRRLKLRKVRDEGEEEKRDKSKERWRKERARGGVSEBasic
NLS Segment(s)
PositionSequence
13-74RKSKGGQPSQKRRKDRSRSRSRRLKLRKVRDEGEEEKRDKSKERWRKERARGGVSEGKKGRS
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MHTHTQAEHTEERKSKGGQPSQKRRKDRSRSRSRRLKLRKVRDEGEEEKRDKSKERWRKERARGGVSEGKKGRSEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.47
4 0.54
5 0.55
6 0.62
7 0.7
8 0.75
9 0.82
10 0.84
11 0.83
12 0.85
13 0.87
14 0.87
15 0.87
16 0.88
17 0.89
18 0.91
19 0.92
20 0.87
21 0.87
22 0.85
23 0.85
24 0.84
25 0.84
26 0.83
27 0.78
28 0.75
29 0.68
30 0.65
31 0.6
32 0.59
33 0.55
34 0.47
35 0.45
36 0.45
37 0.43
38 0.41
39 0.43
40 0.46
41 0.5
42 0.59
43 0.66
44 0.73
45 0.82
46 0.88
47 0.89
48 0.87
49 0.83
50 0.74
51 0.71
52 0.7
53 0.62
54 0.61
55 0.54
56 0.49