Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197K4L7

Protein Details
Accession A0A197K4L7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGSKSKSKSPSKRAPATSEPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 15.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MGSKSKSKSPSKRAPATSEPQDHAAPANKRPKKSNEMSSSIMLNDEEPQEEPSIDVDMEEVQDEQKATTQDQEENVDNDDSDNDLELQNDRESSDDELDVEDDEDQELRSNARSTSQKEAHTSDRVHKALSNPEIEAAFQDKYMTQITQAFGDELNTLRETDSLEGAQLELLIDSLNQTGHIYRVMEKELWVAEESQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.75
5 0.7
6 0.63
7 0.57
8 0.51
9 0.44
10 0.39
11 0.39
12 0.34
13 0.36
14 0.44
15 0.46
16 0.5
17 0.57
18 0.61
19 0.63
20 0.67
21 0.69
22 0.66
23 0.66
24 0.65
25 0.6
26 0.53
27 0.43
28 0.36
29 0.26
30 0.18
31 0.15
32 0.12
33 0.11
34 0.11
35 0.12
36 0.12
37 0.12
38 0.11
39 0.1
40 0.1
41 0.09
42 0.08
43 0.07
44 0.06
45 0.07
46 0.07
47 0.06
48 0.05
49 0.06
50 0.07
51 0.06
52 0.09
53 0.1
54 0.1
55 0.13
56 0.15
57 0.16
58 0.17
59 0.2
60 0.19
61 0.19
62 0.2
63 0.16
64 0.14
65 0.13
66 0.11
67 0.09
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.1
81 0.1
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.12
100 0.16
101 0.19
102 0.27
103 0.32
104 0.33
105 0.35
106 0.38
107 0.38
108 0.39
109 0.38
110 0.36
111 0.39
112 0.37
113 0.34
114 0.33
115 0.32
116 0.34
117 0.35
118 0.3
119 0.23
120 0.23
121 0.23
122 0.21
123 0.19
124 0.14
125 0.11
126 0.09
127 0.1
128 0.09
129 0.11
130 0.12
131 0.11
132 0.1
133 0.13
134 0.14
135 0.15
136 0.15
137 0.14
138 0.12
139 0.13
140 0.12
141 0.1
142 0.12
143 0.11
144 0.11
145 0.11
146 0.11
147 0.12
148 0.12
149 0.13
150 0.11
151 0.11
152 0.1
153 0.1
154 0.1
155 0.08
156 0.07
157 0.05
158 0.05
159 0.04
160 0.04
161 0.05
162 0.06
163 0.06
164 0.06
165 0.07
166 0.08
167 0.09
168 0.12
169 0.13
170 0.16
171 0.19
172 0.22
173 0.22
174 0.22
175 0.24
176 0.23
177 0.23