Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JRN7

Protein Details
Accession A0A197JRN7    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-64MKRTKISKARRDEGRRERKERKERKERKANKQQTNKRRDGRKEKRRERKGGKRKSGKMYRNNKVBasic
NLS Segment(s)
PositionSequence
3-58RTKISKARRDEGRRERKERKERKERKANKQQTNKRRDGRKEKRRERKGGKRKSGKM
Subcellular Location(s) nucl 18, mito 5, cyto 2, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKRTKISKARRDEGRRERKERKERKERKANKQQTNKRRDGRKEKRRERKGGKRKSGKMYRNNKVGEAESQQARTRGSVMSVLIVLLTFFSFFYVYRTFCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.86
4 0.88
5 0.88
6 0.9
7 0.9
8 0.9
9 0.9
10 0.91
11 0.92
12 0.93
13 0.92
14 0.92
15 0.93
16 0.93
17 0.91
18 0.92
19 0.91
20 0.91
21 0.9
22 0.88
23 0.84
24 0.83
25 0.83
26 0.83
27 0.84
28 0.84
29 0.86
30 0.88
31 0.91
32 0.91
33 0.91
34 0.9
35 0.9
36 0.9
37 0.89
38 0.89
39 0.88
40 0.85
41 0.85
42 0.85
43 0.82
44 0.82
45 0.81
46 0.78
47 0.76
48 0.7
49 0.62
50 0.54
51 0.47
52 0.4
53 0.33
54 0.3
55 0.24
56 0.25
57 0.26
58 0.25
59 0.24
60 0.21
61 0.19
62 0.15
63 0.15
64 0.14
65 0.12
66 0.12
67 0.11
68 0.1
69 0.09
70 0.08
71 0.07
72 0.05
73 0.05
74 0.04
75 0.04
76 0.05
77 0.06
78 0.06
79 0.11
80 0.14
81 0.15