Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JF85

Protein Details
Accession A0A197JF85    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-69SSLRGFARRSRRRAQRRLAVDEAHydrophilic
NLS Segment(s)
PositionSequence
55-59RSRRR
Subcellular Location(s) extr 15, plas 4, mito 3, golg 3
Family & Domain DBs
Amino Acid Sequences MVLSTFSSAALMISLIASSGPSSLINDLKQDDSDSDDYPGIDSNCTSSLRGFARRSRRRAQRRLAVDEAVELDDYFPSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.08
11 0.11
12 0.11
13 0.12
14 0.14
15 0.14
16 0.14
17 0.14
18 0.12
19 0.14
20 0.15
21 0.14
22 0.14
23 0.14
24 0.13
25 0.13
26 0.14
27 0.1
28 0.08
29 0.07
30 0.07
31 0.09
32 0.1
33 0.1
34 0.08
35 0.13
36 0.15
37 0.22
38 0.24
39 0.29
40 0.4
41 0.48
42 0.55
43 0.6
44 0.69
45 0.73
46 0.8
47 0.83
48 0.81
49 0.81
50 0.81
51 0.75
52 0.66
53 0.56
54 0.47
55 0.39
56 0.3
57 0.23
58 0.15
59 0.11
60 0.1