Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JXR9

Protein Details
Accession A0A197JXR9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-42PKVTKKETTKVSKRSAKNEEVKQKKKKRAKKDPNAPKNPLSHydrophilic
NLS Segment(s)
PositionSequence
10-36TKVSKRSAKNEEVKQKKKKRAKKDPNA
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKVTKKETTKVSKRSAKNEEVKQKKKKRAKKDPNAPKNPLSAYLLFCNDHRDRVKSDNPDASFGEIGRKLGDMWRNYSDDKKAPYNAKHEKAKAAYAKEKAAYDAKKANGSDDDDDEDEDESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.79
4 0.78
5 0.78
6 0.79
7 0.79
8 0.81
9 0.84
10 0.85
11 0.86
12 0.87
13 0.89
14 0.89
15 0.89
16 0.9
17 0.91
18 0.92
19 0.93
20 0.94
21 0.94
22 0.93
23 0.87
24 0.79
25 0.71
26 0.61
27 0.52
28 0.44
29 0.35
30 0.28
31 0.26
32 0.25
33 0.21
34 0.2
35 0.24
36 0.21
37 0.25
38 0.25
39 0.25
40 0.26
41 0.32
42 0.37
43 0.35
44 0.39
45 0.39
46 0.37
47 0.37
48 0.34
49 0.3
50 0.24
51 0.19
52 0.18
53 0.12
54 0.12
55 0.1
56 0.09
57 0.08
58 0.12
59 0.17
60 0.15
61 0.19
62 0.22
63 0.24
64 0.25
65 0.28
66 0.29
67 0.27
68 0.3
69 0.3
70 0.32
71 0.37
72 0.4
73 0.47
74 0.52
75 0.56
76 0.59
77 0.57
78 0.58
79 0.54
80 0.56
81 0.52
82 0.5
83 0.5
84 0.46
85 0.47
86 0.43
87 0.41
88 0.38
89 0.4
90 0.35
91 0.33
92 0.37
93 0.36
94 0.39
95 0.38
96 0.38
97 0.35
98 0.37
99 0.35
100 0.32
101 0.33
102 0.28
103 0.29
104 0.26