Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KCL5

Protein Details
Accession A0A197KCL5   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-69RIKRVGMYMRKRDKRQRRTTRVGMRKRTKEEKRRKMKEGRKEGRGBasic
NLS Segment(s)
PositionSequence
33-76MRKRDKRQRRTTRVGMRKRTKEEKRRKMKEGRKEGRGERGKGRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, cyto 3
Family & Domain DBs
Amino Acid Sequences MGADDLCNSQEMNESKRDDYVQTIRIKRVGMYMRKRDKRQRRTTRVGMRKRTKEEKRRKMKEGRKEGRGERGKGRRGQCSLKTTDDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.3
4 0.31
5 0.25
6 0.29
7 0.31
8 0.31
9 0.36
10 0.39
11 0.38
12 0.39
13 0.39
14 0.33
15 0.35
16 0.35
17 0.37
18 0.42
19 0.51
20 0.59
21 0.66
22 0.73
23 0.76
24 0.8
25 0.82
26 0.84
27 0.85
28 0.84
29 0.85
30 0.87
31 0.87
32 0.86
33 0.84
34 0.83
35 0.81
36 0.8
37 0.79
38 0.8
39 0.79
40 0.8
41 0.82
42 0.83
43 0.85
44 0.85
45 0.86
46 0.87
47 0.85
48 0.85
49 0.85
50 0.83
51 0.8
52 0.79
53 0.75
54 0.74
55 0.73
56 0.67
57 0.66
58 0.67
59 0.66
60 0.67
61 0.68
62 0.66
63 0.65
64 0.69
65 0.67
66 0.65
67 0.63