Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197KET7

Protein Details
Accession A0A197KET7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-102REREREREREREREREKRVCBasic
NLS Segment(s)
PositionSequence
24-99RDKKSAEEREKERRKGWREGGKEGREGGREGGKGREEKRREEKKEKGEQENEEYEREREREREREREREREREREK
Subcellular Location(s) nucl 14, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MVGYVFVCWYGCMLNDCMDVQKIRDKKSAEEREKERRKGWREGGKEGREGGREGGKGREEKRREEKKEKGEQENEEYEREREREREREREREREREREKRVCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.16
5 0.18
6 0.17
7 0.16
8 0.23
9 0.26
10 0.29
11 0.35
12 0.35
13 0.39
14 0.5
15 0.59
16 0.58
17 0.61
18 0.64
19 0.69
20 0.76
21 0.74
22 0.69
23 0.67
24 0.66
25 0.66
26 0.68
27 0.66
28 0.61
29 0.65
30 0.69
31 0.62
32 0.57
33 0.5
34 0.43
35 0.35
36 0.31
37 0.24
38 0.17
39 0.16
40 0.16
41 0.17
42 0.17
43 0.2
44 0.22
45 0.3
46 0.3
47 0.37
48 0.47
49 0.55
50 0.6
51 0.66
52 0.71
53 0.72
54 0.8
55 0.79
56 0.77
57 0.72
58 0.68
59 0.65
60 0.63
61 0.55
62 0.47
63 0.42
64 0.35
65 0.33
66 0.31
67 0.28
68 0.28
69 0.33
70 0.41
71 0.46
72 0.56
73 0.59
74 0.67
75 0.71
76 0.76
77 0.76
78 0.76
79 0.76
80 0.76
81 0.79
82 0.78
83 0.81