Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K1Q6

Protein Details
Accession A0A197K1Q6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-26LQNVSSSRRKSRKAHFSAPSHydrophilic
NLS Segment(s)
PositionSequence
16-19KSRK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MEDSVHLQNVSSSRRKSRKAHFSAPSDLRRKIMSASLSKELREKHSARSIPIRKDDEVMVVRGSFKGREGKVVQVYRRKWVIHIERVNREKANGAAVPVGIHPSKVVVTKIHMDKDRKDLLERKDRSKKTEAMQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.64
4 0.7
5 0.75
6 0.76
7 0.8
8 0.78
9 0.75
10 0.77
11 0.76
12 0.74
13 0.69
14 0.62
15 0.54
16 0.47
17 0.42
18 0.35
19 0.32
20 0.28
21 0.28
22 0.31
23 0.36
24 0.36
25 0.35
26 0.37
27 0.35
28 0.35
29 0.37
30 0.34
31 0.33
32 0.41
33 0.42
34 0.42
35 0.5
36 0.51
37 0.49
38 0.54
39 0.52
40 0.44
41 0.44
42 0.41
43 0.35
44 0.3
45 0.25
46 0.18
47 0.14
48 0.14
49 0.13
50 0.13
51 0.08
52 0.09
53 0.14
54 0.14
55 0.19
56 0.2
57 0.23
58 0.3
59 0.34
60 0.36
61 0.38
62 0.39
63 0.39
64 0.42
65 0.38
66 0.32
67 0.38
68 0.4
69 0.42
70 0.48
71 0.5
72 0.55
73 0.58
74 0.6
75 0.51
76 0.44
77 0.37
78 0.3
79 0.28
80 0.2
81 0.17
82 0.14
83 0.14
84 0.14
85 0.12
86 0.14
87 0.1
88 0.09
89 0.08
90 0.09
91 0.1
92 0.12
93 0.13
94 0.12
95 0.15
96 0.23
97 0.28
98 0.34
99 0.39
100 0.42
101 0.44
102 0.51
103 0.54
104 0.49
105 0.51
106 0.52
107 0.54
108 0.6
109 0.62
110 0.64
111 0.68
112 0.7
113 0.71
114 0.71
115 0.69