Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197KG44

Protein Details
Accession A0A197KG44    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-44DLLGGGKKRKKKTYTTPKKIKHKKRKVKLAVLKFYQBasic
NLS Segment(s)
PositionSequence
14-36GKKRKKKTYTTPKKIKHKKRKVK
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences MSTLDLNVDLLGGGKKRKKKTYTTPKKIKHKKRKVKLAVLKFYQVDGNGKITRLRRECPSETCGAGVFMAWHHDRQYCGRCGLTYVFKKEGETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.4
4 0.5
5 0.55
6 0.62
7 0.71
8 0.76
9 0.81
10 0.84
11 0.87
12 0.87
13 0.92
14 0.93
15 0.93
16 0.93
17 0.93
18 0.93
19 0.93
20 0.94
21 0.92
22 0.92
23 0.9
24 0.88
25 0.85
26 0.75
27 0.68
28 0.57
29 0.48
30 0.38
31 0.29
32 0.21
33 0.14
34 0.16
35 0.14
36 0.14
37 0.17
38 0.19
39 0.26
40 0.27
41 0.29
42 0.31
43 0.38
44 0.41
45 0.42
46 0.43
47 0.38
48 0.35
49 0.32
50 0.27
51 0.2
52 0.17
53 0.12
54 0.08
55 0.06
56 0.1
57 0.11
58 0.11
59 0.13
60 0.15
61 0.17
62 0.24
63 0.3
64 0.3
65 0.32
66 0.32
67 0.3
68 0.32
69 0.34
70 0.37
71 0.38
72 0.4
73 0.42
74 0.41