Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K795

Protein Details
Accession A0A197K795    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-64QTERWRKQSRGQSNDPGTRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MSAYLLFCGEWREKVKAQNPESSFGKDHAFFAFLGQTSNRQRDIQTERWRKQSRGQSNDPGTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.5
4 0.51
5 0.55
6 0.52
7 0.53
8 0.52
9 0.47
10 0.41
11 0.33
12 0.32
13 0.24
14 0.23
15 0.17
16 0.16
17 0.12
18 0.12
19 0.11
20 0.09
21 0.09
22 0.08
23 0.14
24 0.17
25 0.2
26 0.21
27 0.21
28 0.21
29 0.28
30 0.36
31 0.4
32 0.47
33 0.55
34 0.57
35 0.67
36 0.72
37 0.68
38 0.69
39 0.7
40 0.7
41 0.68
42 0.71
43 0.71
44 0.75