Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K309

Protein Details
Accession I2K309    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
191-212FDPHKVLRLKPHNGKHKKSEGSBasic
NLS Segment(s)
PositionSequence
206-208KHK
Subcellular Location(s) nucl 18.5, mito_nucl 12.833, mito 6, cyto_mito 4.833
Family & Domain DBs
Amino Acid Sequences MLFQRDDREGRIFCRVFPISAVKLYKNCKDXPLTLKLLVSISRITGEVYIVPGNLDRNNWSAEENCGELIPDYESFRQLYLTVFKYISSKEVRLSGDPIKKYFMSLRQQSQKVMLLLMLCRPALLDSSWRDKPDGVSRTLKNDRDKKNNFSKVARKNNGDFNKRHKRALSHEHDEIEESYMAYYNDKVKLGFDPHKVLRLKPHNGKHKKSEGSLKGELNPIGSTYSFELA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.32
4 0.33
5 0.36
6 0.29
7 0.35
8 0.38
9 0.33
10 0.38
11 0.43
12 0.47
13 0.46
14 0.47
15 0.42
16 0.47
17 0.46
18 0.45
19 0.47
20 0.43
21 0.37
22 0.39
23 0.38
24 0.32
25 0.31
26 0.25
27 0.18
28 0.16
29 0.16
30 0.11
31 0.11
32 0.1
33 0.09
34 0.1
35 0.1
36 0.09
37 0.09
38 0.09
39 0.11
40 0.11
41 0.12
42 0.13
43 0.14
44 0.15
45 0.16
46 0.16
47 0.15
48 0.16
49 0.17
50 0.15
51 0.13
52 0.12
53 0.12
54 0.1
55 0.1
56 0.09
57 0.08
58 0.1
59 0.11
60 0.12
61 0.12
62 0.12
63 0.12
64 0.11
65 0.12
66 0.13
67 0.15
68 0.16
69 0.15
70 0.16
71 0.17
72 0.17
73 0.2
74 0.18
75 0.17
76 0.17
77 0.21
78 0.22
79 0.21
80 0.25
81 0.27
82 0.3
83 0.3
84 0.3
85 0.28
86 0.27
87 0.27
88 0.26
89 0.27
90 0.28
91 0.32
92 0.38
93 0.43
94 0.44
95 0.43
96 0.42
97 0.37
98 0.3
99 0.25
100 0.19
101 0.12
102 0.11
103 0.12
104 0.1
105 0.07
106 0.07
107 0.07
108 0.06
109 0.07
110 0.07
111 0.09
112 0.11
113 0.17
114 0.2
115 0.2
116 0.21
117 0.2
118 0.23
119 0.28
120 0.28
121 0.27
122 0.31
123 0.32
124 0.4
125 0.46
126 0.48
127 0.49
128 0.55
129 0.58
130 0.63
131 0.67
132 0.67
133 0.71
134 0.73
135 0.69
136 0.67
137 0.69
138 0.68
139 0.74
140 0.72
141 0.66
142 0.61
143 0.67
144 0.68
145 0.65
146 0.59
147 0.59
148 0.64
149 0.62
150 0.63
151 0.57
152 0.54
153 0.56
154 0.62
155 0.61
156 0.56
157 0.57
158 0.54
159 0.5
160 0.46
161 0.38
162 0.3
163 0.21
164 0.15
165 0.12
166 0.12
167 0.11
168 0.1
169 0.12
170 0.13
171 0.16
172 0.16
173 0.16
174 0.16
175 0.2
176 0.27
177 0.31
178 0.32
179 0.37
180 0.38
181 0.46
182 0.46
183 0.44
184 0.47
185 0.5
186 0.56
187 0.58
188 0.65
189 0.69
190 0.77
191 0.83
192 0.81
193 0.82
194 0.78
195 0.75
196 0.76
197 0.73
198 0.71
199 0.7
200 0.63
201 0.57
202 0.55
203 0.49
204 0.4
205 0.33
206 0.26
207 0.22
208 0.19
209 0.18