Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K2W5

Protein Details
Accession I2K2W5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVNVPKTRKTYCKSKKCRKHTQHRVTQYKAGKHydrophilic
NLS Segment(s)
PositionSequence
61-61K
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKSKKCRKHTQHRVTQYKAGKASLYAQGKRRYDRKQAGFGGQTKQVFRKKAKTTKKVVLRLECVVCKAKMQLPLKRCKHFELGGDKKEKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.88
4 0.94
5 0.93
6 0.94
7 0.94
8 0.94
9 0.93
10 0.93
11 0.92
12 0.85
13 0.83
14 0.76
15 0.71
16 0.62
17 0.52
18 0.42
19 0.34
20 0.32
21 0.32
22 0.32
23 0.3
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.51
30 0.55
31 0.61
32 0.59
33 0.59
34 0.58
35 0.57
36 0.53
37 0.49
38 0.42
39 0.36
40 0.32
41 0.26
42 0.3
43 0.3
44 0.31
45 0.33
46 0.39
47 0.45
48 0.54
49 0.63
50 0.65
51 0.68
52 0.72
53 0.77
54 0.76
55 0.74
56 0.7
57 0.63
58 0.59
59 0.55
60 0.47
61 0.41
62 0.37
63 0.3
64 0.25
65 0.24
66 0.24
67 0.29
68 0.35
69 0.38
70 0.43
71 0.53
72 0.6
73 0.65
74 0.64
75 0.6
76 0.61
77 0.57
78 0.57
79 0.58
80 0.59
81 0.6
82 0.62
83 0.57
84 0.51
85 0.5
86 0.43