Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197K1B5

Protein Details
Accession A0A197K1B5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-74DKTAKRVRTYQQQQRKRDKVEPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 6, plas 5, E.R. 5, golg 5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLKSYILGSYIFQKLFSLSIWFILLGIPTIIIVTLFFYTAKGTGNVAGFIVDKTAKRVRTYQQQQRKRDKVEPAIGTQQQHQQQQQQYRANAFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.17
5 0.15
6 0.11
7 0.12
8 0.12
9 0.12
10 0.11
11 0.1
12 0.1
13 0.06
14 0.06
15 0.04
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.04
22 0.04
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.06
30 0.07
31 0.08
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.11
42 0.16
43 0.18
44 0.19
45 0.24
46 0.29
47 0.39
48 0.49
49 0.54
50 0.61
51 0.68
52 0.76
53 0.82
54 0.85
55 0.8
56 0.78
57 0.76
58 0.74
59 0.73
60 0.67
61 0.61
62 0.6
63 0.57
64 0.51
65 0.46
66 0.44
67 0.41
68 0.44
69 0.43
70 0.43
71 0.48
72 0.56
73 0.61
74 0.62
75 0.6