Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JTP2

Protein Details
Accession A0A197JTP2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-37ALKSRQRRLTIQPKPKPKFKSTHydrophilic
141-163GDAGRGRRRKKMSNVDRRIPLRFBasic
NLS Segment(s)
PositionSequence
145-151RGRRRKK
Subcellular Location(s) mito 22, mito_nucl 13.833, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKSLHPLDILHLKSQALKSRQRRLTIQPKPKPKFKSTITNSAFIVKSARPQPQNLSNANPDNLSKTRRIISNSRGNAVEFSQLVDGDNIQEFSRVIKLRAATMTNVPLEVWETKLLCFGATSKKRYLVAEWLFEGVAEWNGDAGRGRRRKKMSNVDRRIPLRFGGGFFELDILKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.37
4 0.44
5 0.52
6 0.61
7 0.67
8 0.67
9 0.68
10 0.7
11 0.74
12 0.75
13 0.77
14 0.75
15 0.8
16 0.81
17 0.84
18 0.81
19 0.76
20 0.74
21 0.69
22 0.71
23 0.66
24 0.71
25 0.65
26 0.6
27 0.55
28 0.51
29 0.45
30 0.34
31 0.3
32 0.2
33 0.23
34 0.26
35 0.32
36 0.3
37 0.32
38 0.38
39 0.43
40 0.48
41 0.44
42 0.43
43 0.41
44 0.41
45 0.4
46 0.34
47 0.27
48 0.26
49 0.27
50 0.25
51 0.21
52 0.22
53 0.24
54 0.26
55 0.3
56 0.31
57 0.36
58 0.43
59 0.42
60 0.42
61 0.39
62 0.36
63 0.33
64 0.28
65 0.21
66 0.12
67 0.11
68 0.09
69 0.08
70 0.08
71 0.07
72 0.06
73 0.05
74 0.06
75 0.06
76 0.05
77 0.06
78 0.05
79 0.06
80 0.11
81 0.11
82 0.11
83 0.13
84 0.13
85 0.15
86 0.17
87 0.17
88 0.14
89 0.15
90 0.17
91 0.15
92 0.14
93 0.12
94 0.1
95 0.11
96 0.1
97 0.1
98 0.09
99 0.1
100 0.1
101 0.12
102 0.12
103 0.1
104 0.09
105 0.1
106 0.19
107 0.24
108 0.28
109 0.29
110 0.33
111 0.35
112 0.36
113 0.37
114 0.36
115 0.34
116 0.33
117 0.31
118 0.28
119 0.26
120 0.24
121 0.22
122 0.13
123 0.11
124 0.08
125 0.07
126 0.06
127 0.06
128 0.07
129 0.09
130 0.11
131 0.2
132 0.29
133 0.33
134 0.42
135 0.5
136 0.58
137 0.67
138 0.75
139 0.77
140 0.8
141 0.85
142 0.84
143 0.86
144 0.81
145 0.75
146 0.65
147 0.55
148 0.5
149 0.42
150 0.35
151 0.31
152 0.29
153 0.24
154 0.22
155 0.23